KEGG   Cricetulus griseus (Chinese hamster): 100760989
Entry
100760989         CDS       T02813                                 

Gene name
Nfatc3
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 3 isoform X1
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04010  MAPK signaling pathway
cge04022  cGMP-PKG signaling pathway
cge04218  Cellular senescence
cge04310  Wnt signaling pathway
cge04360  Axon guidance
cge04625  C-type lectin receptor signaling pathway
cge04658  Th1 and Th2 cell differentiation
cge04659  Th17 cell differentiation
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04921  Oxytocin signaling pathway
cge05135  Yersinia infection
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100760989 (Nfatc3)
   04310 Wnt signaling pathway
    100760989 (Nfatc3)
   04022 cGMP-PKG signaling pathway
    100760989 (Nfatc3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100760989 (Nfatc3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100760989 (Nfatc3)
   04660 T cell receptor signaling pathway
    100760989 (Nfatc3)
   04658 Th1 and Th2 cell differentiation
    100760989 (Nfatc3)
   04659 Th17 cell differentiation
    100760989 (Nfatc3)
   04662 B cell receptor signaling pathway
    100760989 (Nfatc3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100760989 (Nfatc3)
  09158 Development and regeneration
   04360 Axon guidance
    100760989 (Nfatc3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100760989 (Nfatc3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100760989 (Nfatc3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100760989 (Nfatc3)
   05170 Human immunodeficiency virus 1 infection
    100760989 (Nfatc3)
   05161 Hepatitis B
    100760989 (Nfatc3)
   05163 Human cytomegalovirus infection
    100760989 (Nfatc3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100760989 (Nfatc3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cge03000]
    100760989 (Nfatc3)
Transcription factors [BR:cge03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    100760989 (Nfatc3)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 100760989
NCBI-ProteinID: XP_027261692
UniProt: G3HKW1
LinkDB
Position
3
AA seq 1109 aa
MTTANCGAHDELDFKLVFGEDGAPAPVSQVSRPADLEPDDCASIYIFNVDPPPSTLNSSL
GLPHHGLLQSHSSVLSPSFQLQGHKNYEGTGDISESKYSPLGGSKPFECPSIQITSISPN
CHQGTDVHEDDLQINDPEREYLERPSRDHLYLPLEPSYRESSFSPSPASSISSRSWFSDA
SSCESLSHIYDDVDSELNEAAARFTLGSPLTSPGGSPGGCPGEDSWQQQYGPGHSLSPRQ
SPCHSPRSSITDENWLSPRPASGPSSRPTSPCGKRRHSSAEVCYAGSLSPHHSPVPSPGH
SPRGSVTEDTWLTASVHTGSGLGPAPFPFQYCVETDIPLKTRKTSEDQAVILSGKLEICS
DDQGSLSPSRETSVDDALGSPYALKKDSSGDQFLSVPSPFTWSKPKPGHTPVFRTSSLPP
LDWPLPTHFGQCELKIEVQPKTHHRAHYETEGSRGAVKASTGGHPVVKLLGYSEKPINLQ
MFIGTADDRYLRPHAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAG
ILKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQPSGKVLSLQIASIPVECSQRSAQEL
PHIEKYSINSCSVNGGHEMIVTGSNFLPESKIIFLEKGQDGRPHWEAEGKIIREKCQGAH
IVLEVPPYHNPAVTAAVQVHFYLCNGKRKKSQSQRFTYTPVLMKQEQREDTDLSSVPSLP
VPHSAQTQRPSSVTGHPHDSVLSASRSLICPIQPAYASMITSSHLPQLQCGDEGASKEQH
IIPSSVMHQPFQVTSTSPMGSSYQSIQTNMYNGPTCLPMNPASSQEFDPVLFQQDAALST
LVNLGCQPLSPIPFHSSNSDATGHLLAHSPHSVQTPPHLQSMGYHCSNTGQRSLSSPVAD
QVTGQPSSHLQPITYCPSHPGSAPAASPAASHPLANSPLSGPSSSQLQSMPYQSPSSGTA
SSPSPATRMHSGQHSTQAQSTGQEGLSALSSLVCHSLCDPASFPPGGAAVSIKPEPEDQE
PNFATIGLQDITLDDVVMLSSLTQTSLCLTWNTSHQVQQRNGLITVSSHVQFLSGESRGE
RDNWERHVPDFCFPRPRAAMILSHGVLTV
NT seq 3330 nt   +upstreamnt  +downstreamnt
atgactactgcaaactgtggcgcccacgacgagctcgacttcaaactcgtctttggcgag
gacggggcaccagcgccggtgtcccaggtctcgcggcctgcagatcttgagcctgatgat
tgtgcatccatttacatctttaatgtagatccacctccatctaccttaaactcatcactt
ggcttaccacatcatggattgctgcaatctcattcttctgttttgtcaccatcatttcag
ctccaaggtcacaaaaattatgaaggaactggtgatatttctgaatctaaatatagccca
ttaggtggttccaaaccctttgagtgcccaagtattcaaattacatccatctctcctaac
tgtcatcaaggaactgatgtacatgaagatgacctacagataaatgacccagaaagggaa
tatttggaaagaccttctagagatcatctctatcttccacttgagccatcctaccgggaa
tcttcctttagtcctagtcctgccagcagcatttcttctaggagctggttctcagatgca
tcttcttgtgaatctctctcacacatttatgatgatgtggactcagagttgaatgaagct
gctgctcggtttactcttggctcacctctgacttctccaggtggctctccaggaggctgt
cctggagaagactcctggcagcaacagtatggacctggacactccttgtcacctaggcaa
tctccttgccactctcctagatccagtatcactgatgagaattggctgagccccagacca
gcctcaggaccctcatcaaggcccacttctccctgtggtaaacgacggcactcgagtgct
gaagtatgttatgctggttccctttctccccatcactcacctgttccatcccctggccac
tcccctaggggaagtgtaacagaagatacctggcttactgcttctgtccacactggatca
ggccttggccccgcacctttcccatttcagtactgtgtggagactgatatccctttgaaa
acaaggaagacttctgaagatcaagctgtcatactatcaggaaaattagagatctgttca
gatgatcaagggagcttatcaccatcccgggagacttcagtagatgatgcccttggatct
ccatatgctttaaagaaagattcatctggtgaccaatttctttcagttccttcacccttt
acctggagcaaaccaaagcctggccacacccctgtttttcgcacatcttcgttacctcca
ttagactggcctttaccaactcactttggacaatgtgaattgaaaatagaagtgcaacct
aaaactcatcatcgagcccattatgaaactgaaggtagccgaggggcagtgaaagcctct
actggtggccatcctgttgtgaagctcctgggctatagtgaaaagccaataaatctacag
atgtttattggaacagctgatgaccggtatttacgacctcacgcattttaccaggtgcat
cgcattactggaaagacagttgctactgcaagtcaagagataataattgccagcacaaaa
gttctggaaattccacttctacctgaaaataatatgtcagccagtattgactgtgcaggt
attttgaaactccgaaattcagatatagaacttcgaaaaggagaaactgatattggcaga
aagaatactagagtacgacttgtatttcgtgtgcacatcccacagcccagtggaaaagtt
ctttctctgcagatagcatctattcctgttgagtgctctcagcgatctgctcaagaactc
cctcatattgagaagtacagtatcaacagttgctctgtcaatggaggccatgaaatgatt
gtgactggatctaattttcttccagaatccaaaataatttttcttgaaaaaggacaagat
ggaagacctcattgggaggctgaaggaaaaataatcagggaaaaatgtcaaggggctcac
attgtccttgaagttcctccctatcataacccagcagttacagctgcagtgcaggtgcac
ttttatctttgcaatggcaagaggaaaaaaagccagtctcaacgttttacttacacacca
gttttgatgaagcaagaacaaagagaagatactgatttgtcttcagttccatccttacct
gtgcctcattctgcccagacccagaggccttcctcagttacagggcacccacatgacagt
gtgttgtcagcatcaagaagcttgatttgtccaatccagccagcatatgcatctatgata
acctcatcccatttgccacagttgcagtgtggggatgagggtgctagtaaagaacagcac
ataataccatcttcagtcatgcaccagccttttcaagttacatcaacatctcctatgggg
tcttcctatcagtctatacaaactaatatgtataatggaccaacatgtcttcctatgaac
cctgcctctagtcaagaatttgatccagttttatttcagcaggatgcagctctttctact
ttagtaaaccttggctgtcaacctctgtcgccaataccatttcattcttcaaattcagat
gcaacaggacatctcttagcacattcacctcattctgtgcagaccccacctcatctacag
tcaatggggtaccattgttcaaacacaggacagagatctctttcttctcctgtggcagac
caggtcacaggtcagccttcttctcatttacaacctattacatactgtccatcacatcca
ggatctgctccagcagcttccccagcagcctctcatcccctggctaattcaccgctttct
gggccatcatcttctcagctgcagtctatgccttatcaatctcctagctcaggaactgcc
tcatcaccatctccagctaccagaatgcattctgggcagcactcaactcaagcacaaagt
acaggccaagaaggtctttctgcactttcatctttagtatgtcacagtttgtgtgaccca
gcatcatttccacctggtggggcagctgtgagcattaaacctgaacctgaagatcaggaa
cctaactttgcaaccattggtctacaggatatcactttagatgatgtagtgatgttgtct
tctctgacacagaccagtttatgtctgacttggaacaccagccatcaggttcaacagaga
aatggcctaatcacagtgagctctcatgtccagttcctttctggagaatctagaggtgaa
cgagataattgggagagacatgtcccagatttctgtttcccaaggcccagagccgcaatg
attctatcccatggtgtcctgactgtatga

KEGG   Cricetulus griseus (Chinese hamster): 100762227
Entry
100762227         CDS       T02813                                 

Gene name
Nfatc2
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 2 isoform X2
  KO
K17332  nuclear factor of activated T-cells, cytoplasmic 2
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04022  cGMP-PKG signaling pathway
cge04218  Cellular senescence
cge04310  Wnt signaling pathway
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04380  Osteoclast differentiation
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04658  Th1 and Th2 cell differentiation
cge04659  Th17 cell differentiation
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04921  Oxytocin signaling pathway
cge05135  Yersinia infection
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100762227 (Nfatc2)
   04370 VEGF signaling pathway
    100762227 (Nfatc2)
   04022 cGMP-PKG signaling pathway
    100762227 (Nfatc2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100762227 (Nfatc2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100762227 (Nfatc2)
   04650 Natural killer cell mediated cytotoxicity
    100762227 (Nfatc2)
   04660 T cell receptor signaling pathway
    100762227 (Nfatc2)
   04658 Th1 and Th2 cell differentiation
    100762227 (Nfatc2)
   04659 Th17 cell differentiation
    100762227 (Nfatc2)
   04662 B cell receptor signaling pathway
    100762227 (Nfatc2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100762227 (Nfatc2)
  09158 Development and regeneration
   04360 Axon guidance
    100762227 (Nfatc2)
   04380 Osteoclast differentiation
    100762227 (Nfatc2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100762227 (Nfatc2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100762227 (Nfatc2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100762227 (Nfatc2)
   05170 Human immunodeficiency virus 1 infection
    100762227 (Nfatc2)
   05161 Hepatitis B
    100762227 (Nfatc2)
   05163 Human cytomegalovirus infection
    100762227 (Nfatc2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100762227 (Nfatc2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cge03000]
    100762227 (Nfatc2)
Transcription factors [BR:cge03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    100762227 (Nfatc2)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 100762227
NCBI-ProteinID: XP_027279126
LinkDB
Position
6
AA seq 922 aa
MDAPEPQPDPDGGDGPGHEPGGSPQDELDFSILFDYDYLNPIEEEPKAISSPSGLAYPDD
VPDYGLKPVNPLASLSGEPPGRFAEPDRIGFQNFLSPAKPAGASGPSPRIEITPSHELMQ
AGGALRGRDTGLPPEQPALALAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFISD
TFSPYTSPCVSPNNAGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVPRP
ASRSSSPGAKRRHSCAEALVAPLPAASPQRSRSPSPQPSPRVAPQDDGIPAGYPPTAGSA
VLMDALNSLATDSPCGIPSKIWKTSPDPTPVSTAPSKAGLARHLYPAVEFLGPCEQEERR
NSAPESILLVPPTWPKQLVPAIPICSLPVTASLPPLEWPLSNQSGSYELRIEVQPKPHHR
AHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITG
KTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTR
VRLVFRVHVPEPSGRIISLQAASNPIECSQRSAHELPMVERQDVDSCLVYGGQQMILTGQ
NFTAESKVVFMEKTPDGQQVWEMEATVDKDKSQPNMLFVEIPEYQNKHIRVPVKVNFYVI
NGKRKRSQPQHFTYHPVPAIKTEPSDEYDPSLICSPAHGGLGSQPYYPQHPMLAESPSCL
VATMAPCQQFRSGLSSPDARYQQQSPAAALYQRSKSLSPGLLGYQQPTLLAAPLGLADAH
RSVLVHAGSQGQGQGSTLPHTSSASQQASPVIHYSPTNQQLRGGGHQEFQHIMYCENLGP
SSARPGPPPINQGQRLSPGSYPTVIQQQTALSQRATKNGPPVSDQKDAVPTGVTVKQEQN
LDQTYLDDELIDTHLSWIQNIL
NT seq 2769 nt   +upstreamnt  +downstreamnt
atggacgccccggagccgcagcccgaccccgacggtggggacggcccaggccacgagccc
gggggcagtccccaggacgagctggacttttccatcctcttcgattatgactatctgaac
cccatcgaagaagaacccaaggccatcagctcaccctccggactcgcatacccggatgat
gtcccggactatggcctcaagccagtcaaccccctcgccagtctctctggcgagccccca
ggccggttcgcagagccggataggatagggttccagaactttctgagcccggccaagcca
gcaggggcttcgggcccgagccctcggatcgagatcactccatcccacgaactgatgcag
gcagggggcgccctccgtgggagagacaccggcctgcccccggagcagccggccctggcc
ctggccggcgtggccgccagcccgaggttcaccctgcccgtgcccggcttcgagggctac
cgcgagccgctttgcttgagccccgctagcagcggctcctctgccagcttcatttccgac
accttctccccctacacctcgccctgcgtctcgcccaataacgccgggcccgacgacctg
tgtccccagtttcaaaacatccctgctcattattcccccagaacctctccaataatgtca
cctcgaaccagcctcgccgaggacagctgcctgggccgacactcgcccgtgccccgtcct
gcgtcccgctcctcctcgcccggtgccaagcggaggcattcgtgcgcagaggccttggtt
gcccctctgcccgcagcctcaccccagcgctcccggagcccctcgccgcagccctcgcct
cgcgtggctccccaggacgacggcatccccgctgggtacccccccacggccggctctgcc
gttctcatggatgccctcaacagcctggccaccgactcgccctgcggcatcccctccaag
atatggaagaccagtcccgacccgactcccgtgtccaccgccccgtccaaggccggcctg
gcccgccacctctaccctgccgtggagttcctggggccgtgcgagcaggaggagaggagg
aactcggcccccgagtccatcctgctggtaccacccacctggcccaagcagctggtgccc
gccatccccatctgcagcctcccggtgactgcatccctccctcccctggagtggccactc
tccaatcagtcaggctcctatgagctgcggatcgaggtccagcccaaaccccatcaccgg
gcccactatgagacggagggcagccgtggtgcagtcaaagcccccacaggaggccaccct
gtggtgcagctccacggctacatggagaacaagcctctggggcttcagatcttcattggg
acagccgatgagaggatccttaagccacacgccttctaccaagtacacaggatcacgggc
aaaaccgttaccaccaccagctatgagaagattgtgggtaacaccaaggtcttggagatc
cccctggagccaaagaacaacatgagggccaccatcgactgtgcaggcatcctgaagctt
cgaaacgccgacatcgagctgcggaagggcgagacagacatcggcaggaagaacacgcgg
gtgcgcctggtgttccgcgtccacgtcccggagcccagtggccgaatcatttccctgcag
gcggcgtccaaccccattgaatgctctcagcgctctgcccacgagctgcccatggtggag
agacaagatgtggacagctgcctggtgtacgggggccagcagatgatcctcacgggccag
aacttcacggctgagtccaaggttgtgttcatggagaagaccccagatgggcagcaggtt
tgggagatggaagccacggtggataaagacaagagccagcctaacatgctttttgttgag
atccccgagtatcagaacaagcacattcgagtgcccgtgaaagtgaacttctacgtcatc
aacggaaagagaaaaagaagtcagccacagcactttacctaccacccagtccctgccatc
aagacggagcccagtgacgagtatgacccgtctctgatctgcagtcctgctcatggaggc
ctggggagccagccgtattacccacagcacccaatgctggccgagtccccttcctgtctt
gtggctactatggccccctgccaacagttccgctcggggctctcatcccccgatgcccgc
taccagcagcagagccccgcagcagctctctaccagaggagcaagagcctgagtccaggc
ctactgggctaccagcagccgaccctcctggcagcacccttgggtctggctgatgcccac
cgctctgtgctggtgcatgctggttctcagggccagggccagggctccaccctgccacac
acatcctcggctagccagcaggcctctcccgtgattcactactcacccaccaaccagcag
cttcgtggcggggggcaccaggagtttcagcatatcatgtactgtgaaaacttgggcccc
agctctgccaggcctggccctcctcccatcaaccaaggccagaggctgagcccaggctcc
taccccacagtcatccaacaacagactgccctgagccaaagagctaccaaaaacggaccc
ccagtcagtgaccagaaggacgctgtgcccactggagtgacagtcaaacaggaacagaat
ctggaccagacctacctggatgacgagctgatagacacacaccttagctggatacaaaac
atattatga

KEGG   Cricetulus griseus (Chinese hamster): 100764851
Entry
100764851         CDS       T02813                                 

Gene name
Nfatc1
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 1 isoform X2
  KO
K04446  nuclear factor of activated T-cells, cytoplasmic 1
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04010  MAPK signaling pathway
cge04022  cGMP-PKG signaling pathway
cge04024  cAMP signaling pathway
cge04218  Cellular senescence
cge04310  Wnt signaling pathway
cge04380  Osteoclast differentiation
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04658  Th1 and Th2 cell differentiation
cge04659  Th17 cell differentiation
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04921  Oxytocin signaling pathway
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge05135  Yersinia infection
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cge05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100764851 (Nfatc1)
   04310 Wnt signaling pathway
    100764851 (Nfatc1)
   04024 cAMP signaling pathway
    100764851 (Nfatc1)
   04022 cGMP-PKG signaling pathway
    100764851 (Nfatc1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100764851 (Nfatc1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100764851 (Nfatc1)
   04650 Natural killer cell mediated cytotoxicity
    100764851 (Nfatc1)
   04660 T cell receptor signaling pathway
    100764851 (Nfatc1)
   04658 Th1 and Th2 cell differentiation
    100764851 (Nfatc1)
   04659 Th17 cell differentiation
    100764851 (Nfatc1)
   04662 B cell receptor signaling pathway
    100764851 (Nfatc1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100764851 (Nfatc1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100764851 (Nfatc1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100764851 (Nfatc1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100764851 (Nfatc1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100764851 (Nfatc1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100764851 (Nfatc1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100764851 (Nfatc1)
   05170 Human immunodeficiency virus 1 infection
    100764851 (Nfatc1)
   05161 Hepatitis B
    100764851 (Nfatc1)
   05163 Human cytomegalovirus infection
    100764851 (Nfatc1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100764851 (Nfatc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cge03000]
    100764851 (Nfatc1)
Transcription factors [BR:cge03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    100764851 (Nfatc1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 100764851
NCBI-ProteinID: XP_027259486
LinkDB
Position
2
AA seq 938 aa
MPSTSFPVPSKFPLGPPAAVCGSGETLRPVPPAGGTMKAAEEEHYSYASPSITSTLPLPT
AHTSLPAPCHDLQTSTPGISAVPSANHPSSYGGAVDSGPSGYFLSSGNTRPNGAPTLESP
RIEITSYLGLHHGSSQFFHDVEVEDVLPSCKRSPSTATLPLPSLEAYRDPSCLSPASSLS
SRSCNSEASSYESNYSYPYASPQTSPWQSPCVSPKTTDPEEGFPRGLGACHLLGSPRHSP
SSSPRASVTEESWLGARGSRPTSPCNKRKYSLNGRQPSCSPHHSPTPSPHGSPRVSVTED
TWLGNTTQYTSSAIVAAINALTTDTLDLGDGVPIKSRKTALEHAPSVALKVEPAGEDLGA
TPPTSDFAPEEFAFQHLRKGAFCEQYLSVPQAPYQWAKPKSLSPTSYMSPSLPALDWQLP
SHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLTLQLFIGT
ADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENNMRAIIDCAGILKLR
NSDIELRKGETDIGRKNTRVRLVFRVHIPQPNGRTLSLQVASNPIECSQRSAQELPLVEK
QSTDSYPVIGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVEI
PPFRNQRITSPVQVSFYVCNGKRKRSQYQHFTYLPANVPIIKTEPTDDFEPALTCGPISQ
GLSPLPRPYYSQQLTMPPNPGSCLVAGFAPCSQRNTLMTTPPNASPKLHDLSSTAYTKSL
TSPGHSGHLGLQPPASEVPTMQEVPRPLALQPNSPEQPPPARLQPQVSPHLNSSCSLGCQ
QVLCPNSPSSPLPSAAHEPTCLQPSALPPDVGHQQQQLQKIQRNESPAALPEVHENTDHS
LAPIPVVIKQEPEELDQLYLDDVNEIIRNDLSSTNPHS
NT seq 2817 nt   +upstreamnt  +downstreamnt
atgccaagtaccagctttccagtcccttccaagtttccactcggccctccggccgcagtc
tgcgggagcggagaaactttgcggcccgtgccgcccgccggcggcaccatgaaggcagcc
gaggaagaacactacagttatgcatcccctagcatcacctcgactctgccccttcctaca
gcacacacttctttgccagcaccatgccatgacctccagacgtccaccccaggcatctca
gctgttccttcagcaaatcacccctcgagttatggaggggctgtggacagtgggccctcg
gggtactttctgtcctccggaaacacccggcccaatggggccccgactctggagagtcct
cgaattgaaatcacctcctacctgggcctccaccatggcagcagccagtttttccacgac
gtagaggtagaagacgtgcttcccagctgcaagcggtcaccatccacagccaccctgccc
ctgcccagcctggaagcatacagagacccctcctgcctgagcccggccagcagcctgtcc
tcaaggagctgtaactctgaggcctcctcctatgagtccaactactcatacccatatgcg
tccccccagacctctccatggcagtcaccctgcgtgtctcccaagaccacagacccagag
gagggctttccccgaggcctgggtgcctgtcaccttctgggatctccaaggcactctcca
tccagctctcctcgtgccagtgtcaccgaggagagctggctgggtgcgcgtggctcccgg
cccacatccccctgcaacaagcgcaagtacagcctcaatggccggcagccctcctgctca
ccccaccactcacccacaccatccccacatggctcccctcgggtcagtgtgactgaagac
acctggctcggtaatactacccagtataccagctctgccatcgtggcagccatcaacgcc
ctaaccactgacactctggacctgggcgatggtgtccctatcaagtctcgaaagacagct
ctagagcatgcgccctcagtggccctcaaggtagaaccagctggggaagacctaggcgcc
actccacccacctctgacttcgcacctgaggagtttgccttccagcacctccggaagggg
gccttttgcgaacagtatctgtcggtgccacaggccccctaccagtgggcgaagcccaag
tctctgtcccctacatcatacatgagcccatctttacctgcccttgactggcagctgcca
tcccactctggtccatatgagcttcggatcgaggtgcagcccaagtctcaccacagggct
cactatgagacagaaggaagtcggggggctgtgaaggcctcagctggaggacaccccatc
gtgcagctacatggttacttggaaaatgagccgctcacgctacagctgttcattgggaca
gcggacgaccgtctgctgcgcccccatgccttctaccaggtccaccggatcacggggaag
actgtctccaccaccagccatgaagccatcctgtccaacaccaaagtcctggagatcccg
ctgcttccagaaaacaacatgcgagccatcatcgactgtgctgggatcctgaagctcaga
aactcagacattgagctgaggaaaggggagacagacatcgggaggaagaacaccagggtg
cgactggtcttccgagtccacatcccacagcccaatggccggacactgtctctccaggtt
gcctcaaaccccatcgagtgctcccagcggtcggcccaggagctgccccttgtggaaaag
caaagcacagacagctacccagtcattggcggcaagaagatggtgctgtctggccataat
tttctgcaagactctaaggtcattttcgtggagaaggccccagatggccatcatgtctgg
gagatggaagcaaaaactgaccgagacctgtgcaagccaaattccctggtggtggagata
ccaccattccgcaaccagaggataaccagccctgtccaagtcagtttctacgtctgcaat
gggaagaggaagagaagccagtaccagcatttcacgtaccttcctgccaatgttccaatt
ataaagacagaacccacggacgactttgagccagctctgacctgtggaccaatcagccag
ggacttagtcctctaccgaggccttactatagccaacagctcaccatgcctcccaaccct
ggctcctgcctcgtggctggctttgccccctgctcacagaggaacaccctgatgaccaca
cctcccaatgcaagcccgaagctccatgacctctcctctactgcctacaccaagagcctc
accagcccaggccacagtggtcaccttggacttcagccgccagcttcggaggtccccacc
atgcaggaagtgccgagacccctggccctgcagcccaactcgcctgagcagcccccacca
gcccggctgcagccgcaggtgagtccacatctgaacagtagctgttcccttggttgccaa
caagtgctctgtcccaacagcccctcttctccacttccgtctgctgcccatgagccaacc
tgcttacagccctcagccctccctcctgacgtgggccaccagcagcaacaactgcagaag
attcaaagaaatgaatctccagctgcactgccagaggtgcatgagaacactgatcatagt
ttggcccctattcctgtagtgatcaagcaagagcctgaggaattggaccagttatacctg
gatgatgtaaatgaaatcattcgcaatgacctctccagcacgaacccccactcctaa

KEGG   Cricetulus griseus (Chinese hamster): 100768420
Entry
100768420         CDS       T02813                                 

Gene name
Nfatc4
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 4
  KO
K17334  nuclear factor of activated T-cells, cytoplasmic 4
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04022  cGMP-PKG signaling pathway
cge04218  Cellular senescence
cge04310  Wnt signaling pathway
cge04360  Axon guidance
cge04625  C-type lectin receptor signaling pathway
cge04921  Oxytocin signaling pathway
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100768420 (Nfatc4)
   04022 cGMP-PKG signaling pathway
    100768420 (Nfatc4)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100768420 (Nfatc4)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100768420 (Nfatc4)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100768420 (Nfatc4)
  09158 Development and regeneration
   04360 Axon guidance
    100768420 (Nfatc4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100768420 (Nfatc4)
   05170 Human immunodeficiency virus 1 infection
    100768420 (Nfatc4)
   05161 Hepatitis B
    100768420 (Nfatc4)
   05163 Human cytomegalovirus infection
    100768420 (Nfatc4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100768420 (Nfatc4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cge03000]
    100768420 (Nfatc4)
Transcription factors [BR:cge03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    100768420 (Nfatc4)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 100768420
NCBI-ProteinID: XP_027246327
LinkDB
Position
1
AA seq 901 aa
MGAASCEDEELEFKLVFGEEKEAPPLGAGGPGEELDSEDAPSCCRLVLGEPLPYGAAPIG
IPRPPPPRPGMHSPPPRPAPSPGTWESQPARSVRLGGPGGSAGGSGGGRVLECPSIRITS
ISPTPDPPTSLEDTPETWGDSSPRDYPPPEGYGGYREAGGQGGGAFFSPSPGSSSLSSWS
FFSDASDEAALYAACDEVESELNEAASRFGLSSPLPSPRASPRPWTPEDPWSLYGPSSGG
RAPEDSWLLLSAPGPIPASPRPASPCGKRRYSSSGTPSSASPALSRRGSLGEEGPEPPPP
PPLPLVRDPSSPGPFDYAGAPTNESIPQKTRRTSNEQAVALPRSEEPASCNGKLPSGTEE
AVAAPGGLRKEVTGMDYLAVPSPLAWSKARIGGHSPIFRTSALPPLDWPLPSQYEQLELR
IEVQPRAHHRAHYETEGSRGAVKAAPGGHPVVKLLGYSEKPLTLQMFIGTADERSLRPHA
FYQVHRITGKMVATASYEAVVSGTKVLEMTLLPENNMAANIDCAGILKLRNSDIELRKGE
TDIGRKNTRVRLVFRVHVPQGGGKVVSVQAASVPIECSQRSAQELPQVEAYSPSACSVRG
GEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEAVVNPLRSSEVTLTLTIPEYSNKRVSR
PVQVYFYVSNGRRKRSPTQSFKFLPVIFKEEPLPDSSLRGFPSTSGSPFGTDMDFSPPRP
PYPSYPHEDPAYETPYLSESFGYSTPTLYPQTGPPPSYRPGLRMFPETGGTTGCARPPPV
SFLPRPFPGDPYGGQGSSFALGLPFSPQAPFRPPLPSSPPLEDPFNPQNAVHPLPAEGYN
EVGPGYTPGEGASEQEKSRGGYSSGFRDNVPIQGITLEEVSEIIGRDLSGFPARPGEEPP
A
NT seq 2706 nt   +upstreamnt  +downstreamnt
atgggggctgcaagctgcgaggatgaagagctggaatttaagctggtgttcggggaggaa
aaggaggctcccccgctgggcgcggggggccctggggaagagctggactcagaggatgcc
ccttcatgctgtcgtttggttctgggggaaccccttccttatggtgctgcccctattggt
attccccgacccccaccccctcggccaggcatgcactcaccaccaccccgtcccgcccct
tcacctggcacctgggagagccagccagctcggtcggtgaggctgggggggccaggaggg
agtgcggggggttctgggggcggtcgtgttcttgaatgtcccagcatccggatcacctcc
atctctcccacgcctgacccaccgacctcgctagaggacacgcctgaaacctggggggac
agctctcctagagattatcccccaccagaaggctacgggggctaccgagaggccggaggc
cagggcggaggtgccttcttcagcccgagccctggcagcagcagcctgtcttcgtggagc
ttcttctccgatgcctcagacgaggccgccctgtatgcagcatgcgatgaggtggagtct
gaacttaatgaagcagcctcccgctttggcttgagctctccattgccttcgccccgggct
tctcctagaccatggaccccggaggatccgtggagcctatacggtccaagctcaggaggc
cgagcgccagaggatagctggctactcctcagcgctcctgggcccatccctgcctcccct
cggcctgcttcaccctgtggcaagaggcgctattccagttcaggaaccccatcttcggcc
tccccagctctgtcccgccggggcagccttggggaagagggtccagagccacccccgcca
cccccattgcctctggtcagggaccctagttctccaggcccttttgactatgcgggagct
ccaacaaacgagagcatccctcagaaaacccggaggacttctaacgagcaggcggtggcc
ctgcctcggtctgaggagcctgcctcgtgcaatgggaagctgccctccggaacagaggag
gctgtggctgctccagggggtctgcggaaagaggtgactggtatggactatctagcagta
ccttctcctcttgcttggtccaaggcccggattgggggacacagccccatcttcaggacc
tctgccctacctcccctggactggcctttgcccagccagtatgagcagctggagctgagg
attgaggtgcagcctagagcacaccaccgagcccactacgagaccgagggcagccgagga
gcggtcaaagctgctcccggaggtcaccctgtggtcaagctcctaggctacagtgagaag
ccactgactctacagatgttcattggcactgcagatgaaaggagcctgcggccgcatgcc
ttctaccaggtgcaccgtattactggcaagatggtggctacggccagctatgaagctgta
gtcagtggtaccaaagtattggagatgaccttgctcccagagaacaacatggctgccaac
attgactgtgctggaatcctgaagcttcggaattcagacattgagctccggaagggtgag
acagacatcgggcgcaaaaacacacgtgtgaggctggtgttccgtgtacacgtgcctcag
ggcggcgggaaggtcgtctctgtgcaggcagcatccgtgcccatcgagtgctcccagcgt
tcagcccaggagctgccccaggtggaggcctacagccccagtgcctgctctgtgagagga
ggggaggaactagtgctgactggttccaacttcctgccagactctaaggtggtattcatc
gagaggggccctgatggaaagctccagtgggaggaggaggctgtggtgaacccgctacgg
agcagcgaggtgacactgactctgaccatccctgagtacagcaacaagcgggtatcccgg
ccagtccaggtctacttttacgtctccaacgggcggaggaagcgcagtcctacccaaagt
ttcaagttcctacctgtgatcttcaaggaggagcccctaccagactcatctctccggggc
ttcccttccacatcgggttccccctttggcactgacatggacttctcaccacccagaccc
ccttacccctcctatccccatgaagaccctgcttacgaaactccttatctgtcagaaagc
tttggttatagcacacccactctgtacccccagacggggcccccaccatcctatagacca
ggcctgcggatgttccctgagactggaggtaccacaggttgtgcccgtccacctccggtc
tctttcctgccccgcccctttcctggtgatccatatggaggacagggctcctcttttgcc
ctggggcttccattctcccctcaggccccctttaggcctccattaccttcctccccacca
ctcgaagaccccttcaatccgcagaatgctgtccaccccctacctgctgagggctacaat
gaggtggggccaggctatacccctggggagggggcttcggagcaggagaaatccaggggt
ggctacagcagcggcttcagagacaatgtacctatccagggtatcaccctggaggaagtg
agtgagatcattggccgagacctgagtggcttccctgcacgtcctggagaagagcctcct
gcctga

DBGET integrated database retrieval system