KEGG   Cricetulus griseus (Chinese hamster): 100761878Help
Entry
100761878         CDS       T02813                                 

Gene name
Kmt5b
Definition
(RefSeq) histone-lysine N-methyltransferase KMT5B isoform X3
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100761878 (Kmt5b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cge03036]
    100761878 (Kmt5b)
Enzymes [BR:cge01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100761878 (Kmt5b)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100761878 (Kmt5b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 100761878
NCBI-ProteinID: XP_027264565
LinkDB All DBs
Position
3
AA seq 882 aa AA seqDB search
MKWLGDSKNMVVNGRRNGGKLSNDHQQNQSKLQHSGKDTLKTGRNAVERRSNRCHGNSGF
EGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTSAFPLRSSRHISKADSFS
HNNPVRFRPIKGRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKE
HVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEEN
MLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPG
EEISCYYGDGFFGENNEFCECYTCERRGTGAFKSRVGLPAPAPVINSKYGLRETDKRLNR
LKKLGDSSKNSDSQSVSSNTDADTTQEKDNATSNRKSSVGVKKSSKSRTLTRQSMPRVPA
ASNSTSPKLTHMNNSRVPKKLRKPAKPLLSKIKLRNHCKRLDQKNASRKLEMGNLVLKEP
KVVLYKNLPIKKEKEPEGPEQAAVGSGCLTRHAAREHRQNPGRGAHSQGDSLPCTYTTRR
SLRTRTGLKEATDIKLEPSPLDGYKNGLLEPCPDSDQHPTPEVLEELAPETAHMEEASQE
CPKSDPCPSRKKFRQGKPMKHLAKAEDCSLEHGFPGKDGLPDLPVPHPDQGEPSGTIGVP
VSYTDSAPSPVGCSIVTPDSFTTKDSFRTAQSKKKRRVTRYDAQLILENSSGIPKLTLRR
RHDSSSKTNDHESDGMNSKISIKLSKDHESDSNLYVAKLSNGVSSGPGGSSTKLKIQLKR
DEESRGPYAEGLHENGVCCSDPLSLLESQMEVDDYSQYEEDSTDDSSSSEGEEEEEDCED
DFDDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQSLRLNA
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttgggagactccaagaacatggtggtgaatggcaggagaaatggaggcaag
ttgtctaatgaccatcagcagaatcaatcaaaattacagcactcgggcaaggacaccctg
aagactggcagaaacgccgttgagaggcggtccaacagatgtcatggtaactcgggattt
gaaggacagagtcgctatgtgccgtcctctggaatgtccgccaaggagctctgtgagaac
gacgacttagcaaccagtttggttcttgatccctatttaggttttcagacacacaaaatg
aatactagcgcctttcctttgaggagctcaagacatatttcaaaagctgacagtttttct
cacaacaaccctgtaagattccggcctattaaaggaaggcaagaagagctaaaggaagta
attgaacgctttaagaaagatgaacacttagagaaagccttcaaatgtttgacttcaggt
gaatgggcacggcattattttctcaacaaaaacaaaatgcaggagaaattattcaaggaa
catgtctttatttacttgcggatgtttgcgactgacagtggatttgaaatattgccttgt
aatagatactcttcagaacaaaatggagccaagatagttgcaacaaaagagtggaaacga
aatgacaaaatagaattactggtgggttgtattgccgaactttcagaaattgaggagaac
atgctacttagacatggagaaaacgacttcagtgtcatgtattccacaaggaaaaactgt
gctcaactctggctcggtcctgctgcatttataaatcatgattgcagacctaactgtaag
tttgtgtcaactggtcgagacacagcatgtgtgaaggctctgagagatattgaacctgga
gaagaaatttcttgttactatggagatgggttttttggagaaaataatgagttctgcgaa
tgttacacttgtgaaagacggggaactggtgcttttaaatccagagtaggactgcctgcg
cctgctcctgttatcaatagcaaatatggactcagagaaacagataaacgcttaaatagg
cttaaaaagttaggtgacagcagcaaaaattcagacagtcagtctgtcagctctaacact
gatgcagacaccactcaggaaaaagacaatgcaacttctaaccgaaaatcttcagttggt
gtaaaaaagagcagcaagagcagaacactgaccaggcagtccatgccaagagtcccagct
gcttctaactctacctcacctaagctaacgcacatgaacaattccagggtaccaaagaaa
ctaagaaagccggcaaagcctttactttccaagatcaaactgaggaatcactgcaagcgg
ctggaccagaagaatgcatcacggaagcttgagatgggaaacttagtgcttaaggagcct
aaagttgtgctatataaaaatttgccaattaagaaagagaaggagccagaggggccagag
caggctgctgtggggagtgggtgcttgacgaggcatgccgccagagaacacaggcagaac
cctgggagaggtgctcactcgcagggggacagtttgccctgcacctacacaacccggcgc
tcattgaggacaaggacaggtctgaaggaagccactgacatcaagcttgaaccaagtccc
ttagatggctataaaaatggccttctggaaccttgcccagacagtgatcagcacccaacc
ccagaggttctggaagaactggctccagagactgcacatatggaggaagcgtcccaggag
tgtcccaagagtgacccatgcccatcaagaaagaaatttcggcaagggaaacccatgaaa
cacttagcaaaggcagaagactgcagtctggagcatggcttccccgggaaagatgggctg
ccagatttgccagttccccatcctgaccagggtgagcccagtggcacgatcggggtgcct
gtgagctacacagactctgctccctcacctgttggctgttccattgtcacacccgacagc
ttcacaacaaaagacagtttcagaactgcacaaagtaaaaagaagcgtcgggtcaccagg
tacgatgcacagctgatactggagaacagctctgggatccccaaactgacacttcgcagg
cggcatgatagcagcagcaagacaaacgaccatgagagtgatggtatgaactcaaaaatc
agcatcaagctcagcaaagaccatgaaagtgacagcaacctctatgtcgcaaagctaagt
aatggggttagctcggggccaggcggcagctctaccaagctcaagatccagctcaagcgg
gatgaggagagcagggggccatatgcagaggggcttcatgagaatggagtgtgctgcagt
gatcccctctccttgctggagtcccagatggaggtggacgactacagtcagtacgaggag
gacagcacagatgattcatcgtcttctgagggagaagaggaggaggaggactgcgaggac
gactttgatgatgacttcatccctcttcctcccgcaaagcggctgaggctaattgttggt
aaagactccatagatatcgacatttcttcaaggagaagagaagatcagtctctaaggctg
aacgcatga

DBGET integrated database retrieval system