KEGG   Cricetulus griseus (Chinese hamster): 100762260
Entry
100762260         CDS       T02813                                 

Gene name
Ep300
Definition
(RefSeq) histone acetyltransferase p300
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04024  cAMP signaling pathway
cge04066  HIF-1 signaling pathway
cge04068  FoxO signaling pathway
cge04110  Cell cycle
cge04310  Wnt signaling pathway
cge04330  Notch signaling pathway
cge04350  TGF-beta signaling pathway
cge04520  Adherens junction
cge04630  JAK-STAT signaling pathway
cge04720  Long-term potentiation
cge04916  Melanogenesis
cge04919  Thyroid hormone signaling pathway
cge04922  Glucagon signaling pathway
cge04935  Growth hormone synthesis, secretion and action
cge05016  Huntington disease
cge05152  Tuberculosis
cge05161  Hepatitis B
cge05164  Influenza A
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05206  MicroRNAs in cancer
cge05211  Renal cell carcinoma
cge05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100762260 (Ep300)
   04330 Notch signaling pathway
    100762260 (Ep300)
   04350 TGF-beta signaling pathway
    100762260 (Ep300)
   04630 JAK-STAT signaling pathway
    100762260 (Ep300)
   04066 HIF-1 signaling pathway
    100762260 (Ep300)
   04068 FoxO signaling pathway
    100762260 (Ep300)
   04024 cAMP signaling pathway
    100762260 (Ep300)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100762260 (Ep300)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100762260 (Ep300)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100762260 (Ep300)
   04935 Growth hormone synthesis, secretion and action
    100762260 (Ep300)
   04919 Thyroid hormone signaling pathway
    100762260 (Ep300)
   04916 Melanogenesis
    100762260 (Ep300)
  09156 Nervous system
   04720 Long-term potentiation
    100762260 (Ep300)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100762260 (Ep300)
   05206 MicroRNAs in cancer
    100762260 (Ep300)
   05203 Viral carcinogenesis
    100762260 (Ep300)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100762260 (Ep300)
   05215 Prostate cancer
    100762260 (Ep300)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100762260 (Ep300)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100762260 (Ep300)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100762260 (Ep300)
   05161 Hepatitis B
    100762260 (Ep300)
   05164 Influenza A
    100762260 (Ep300)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100762260 (Ep300)
   05165 Human papillomavirus infection
    100762260 (Ep300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cge03000]
    100762260 (Ep300)
   03036 Chromosome and associated proteins [BR:cge03036]
    100762260 (Ep300)
   03029 Mitochondrial biogenesis [BR:cge03029]
    100762260 (Ep300)
Enzymes [BR:cge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100762260 (Ep300)
Transcription factors [BR:cge03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    100762260 (Ep300)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100762260 (Ep300)
Mitochondrial biogenesis [BR:cge03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100762260 (Ep300)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 100762260
NCBI-ProteinID: XP_027259874
UniProt: G3I534
LinkDB
Position
2
AA seq 2415 aa
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
ISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPSQVMASQAQQNSPGLGLINS
MVKSPMAQTGLTSPNMGMGSSGPNQGPTQSTTGMMNSPVSQPAMGMNTGMNAGMNPGMLA
AGNGQGIMPNQVMNGSIGAGRGRPNMQYPNPGMGNAGNLLTEPLQQGSPQMGGQTGLRGP
QPLKMGMMSNPSPYGSPYTQNSGQQIGASGLGLQIQAKTVLPNNLSPFAMDKKAVPGGGM
PNMGQQPTPSVQQPGLVTSVAPGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANG
EVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKN
AGDKRNQQSILTGAPVGLGNPSSLGVGQQSAPSLSTVSQIDPSSIERAYAALGLPYQVNQ
IPPQPQVQAKNQQNQQSGQSPQGMRPMNNMSASPMGVNGGVGVQTPNLLSDSMLHSAINS
QNPMMNENASVASLGPLPTAAQPSSTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAA
LKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMIP
NAPGMVPVSMNTGPNMGQQQPGMTTNGPLPDPAMIRGSVPNQMMPRITPQPGLNQFGQMN
MPQPPIGPRQPSPLQHHGQLAQSGALNPPMGYGPRMQQTSSQNQFLSQTQFPSQGMNVTN
MPLTPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCSTLPQQAHQNSPSPVPSRTP
TPHHTPPSIGTQQPPATAIPAPVPTPPAIPPGPQPQALHPPSRQTPTPPTHLPSQVQPSI
PAAPADQSQQQPRSQQSTAAPVPTPTAPLLPPQPSTPLSQPTVSIEGQVSNPPSTSSTEV
NSQTIPEKQPSQEVKMEVKMEVDQPELADAQPEDTQEAKAEDVKVEPTETEDRGTELKPE
TKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQ
LLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYIDDIWLMFNNAWLYNRKTSRVYKYC
SKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCE
KCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHH
EIIWPSGFVCDGCLKKTARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVT
VRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYG
SDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSE
GDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDILKQATEDRLTSAKELP
YFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSS
LSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIACPAPNSLPPIVDPDPLIPCD
LMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWH
CTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSL
VHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCP
VPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVAGQQQGLPSPTPATPTTPTGQQ
PATPQTPQPQPTSQPQPTPPNNMPPYLPRTQTAGPVSQGKAAGQVTPPTPPQTAQPSLPG
PPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPQMAPMAPMGMNPPPMARGPGGHL
EPGMGPTGMQQQPPWAQGGMPQPQQMQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGVSP
LKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQPL
PGQPGMPQGQPGLQPPTMPGQQGVHSNPALQNMNPMQAGVQRAGLPQQQPQQQLQPPMGG
MSPQAQQMNMNHNAMPSQFRDILRRQMMQQQGAGPGIGPGMANHNQFQQPQGIGYPPQQQ
QQQQQRMQHHMQQMQQGNMGQMAQLPQALGAEAGASLQAYQQRLLQQQMGSPAQPNPMSP
QQHMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHV
SPQTSSPHPGLVAAQAANPMEQGHFASPDQNSMLSQLTSNPGMANLHGASATDLGLSTDN
ADLNSNLSQSTLDIH
NT seq 7248 nt   +upstreamnt  +downstreamnt
atggccgagaatgtggtggaaccggggccgccttcagccaagcggcctaaactctcatct
cctgccctctcggcgtcggccagcgatggcacagattttggttcgctgtttgacctggaa
catgacttaccagatgaattaatcaactctacagaattgggactaaccaatggtggcgat
attagtcagcttcagacaagtcttggcatagtgcaagatgcagcctctaaacataaacag
ttgtcagaattgctacggtctggtagttctcctaacctcaatatgggggttggtggccca
agccaagttatggccagccaggcccagcaaaacagccccggattaggtttgataaatagc
atggtcaaaagcccaatggcacagacaggcttgacttctcccaacatggggatgggcagt
agtggaccaaatcagggtcctacacagtccacaacaggtatgatgaacagtccggtgagt
cagcctgccatgggaatgaacacagggatgaatgctggcatgaatcctggaatgttggct
gcaggaaatggacaagggataatgcccaatcaagtcatgaatggttcaattggagcagga
cggggacggccaaatatgcagtaccccaacccaggcatgggcaatgctggcaatttattg
actgagccactacaacagggctctcctcagatgggaggacaaacaggattgagaggcccc
cagccccttaagatgggaatgatgagcaatcccagtccttatggttcaccatatactcag
aattctggacagcagattggagcgagtggtcttggtctccaaattcaggccaagactgta
ttaccaaataacttatctccatttgcaatggacaaaaaggcagttcctggtgggggaatg
cccaacatgggccagcagcctaccccatctgtccagcagccaggcctggtgacttcagtc
gcccctgggatgggttctggagcacacacagctgatccagagaagcgcaagctcatccag
cagcagcttgttctccttttacatgctcacaagtgccagcgccgggagcaggctaatggg
gaagtgaggcaatgcaatcttccccactgtcgaaccatgaaaaatgttctaaaccacatg
acacactgccagtcaggcaagtcctgtcaagtggcacattgtgcatcttctcgacaaatc
atttcacactggaagaattgtacaaggcatgattgtcctgtgtgtcttcctctcaaaaat
gctggggataagcgaaaccaacagtcaattctgactggagcacccgttgggcttggaaac
cctagctcactaggagtgggtcaacagtctgcccctagcttaagcactgttagtcaaatt
gaccccagctctatagagcgagcctatgctgcacttggactaccctatcaagtaaaccag
attccaccacaaccccaggtacaagcaaagaatcaacaaaaccagcagtctgggcagtct
ccccaaggcatgcgacccatgaacaacatgagtgctagtcctatgggtgtaaatggaggt
gtaggggttcagacaccgaatcttctttctgactccatgttgcattcagccataaattct
caaaacccaatgatgaatgaaaacgccagtgtggcctctctgggtcctttgccaacagca
gctcagccatctagtactggaattcggaagcaatggcatgaagatattactcaggatctt
cgaaaccaccttgttcataaacttgttcaagccatatttcccactccggatccagctgct
ttaaaagaccgacggatggaaaaccttgttgcatatgctcgtaaagtagaaggggacatg
tatgaatcagcaaacaatagagcggaatactaccacctcctagctgagaagatctataaa
atccagaaagagctagaagaaaaacggaggactagactacagaaacaaaacatgatacca
aatgctcctggcatggttccagtttctatgaatactggacctaacatgggacagcaacaa
ccagggatgactactaatggtcctctacctgatccagctatgatccgtggcagtgtgcca
aaccagatgatgcctcggataactccccaacctggtttgaatcagtttgggcagatgaat
atgcctcagccccctattggaccccggcaaccctctcctcttcagcaccatggacagttg
gcacagtctggggcactaaatccgcctatgggatatggacctcgaatgcagcagacttcc
agtcagaaccagttcctctctcaaactcagtttccatctcaaggaatgaatgtaacaaac
atgcctttgacaccatccagtggtcaagcacctgtttctcaagcacaaatgtccagttct
tcctgtccagtgaactctcctataatgcctccagggtctcaagggagccatattcactgt
tccactctgcctcaacaagctcatcagaattcgccttctcctgttcctagtcgtacccct
actcctcatcatactcccccaagcatagggactcagcaaccaccagcaacagcaattcca
gctcctgttcctacacctcctgccataccacctggaccacagccccaagctctacacccc
ccatctagacagacaccaacaccaccaacacatcttccttcccaagtacaaccttcaatt
cctgctgctcctgctgaccagtcccagcaacagcctcgatcacagcagagcactgcagct
cctgttcctaccccaacagcaccactgttgccacctcagccttcaactccactttctcag
ccaactgtaagcattgaaggccaggtatcaaaccctccatctactagtagcacagaagtg
aattctcagaccattcccgagaagcaaccttcacaggaagtaaaaatggaggttaaaatg
gaggtggatcaacctgaactagcagatgctcaacctgaagatactcaggaggctaaagct
gaagatgttaaagtggaacctacagaaacagaggacagaggcactgagttaaaacctgaa
acaaaagaggaggaagaccagccaagtacctctgctacgcagtcctccccagctcctgga
cagtcaaagaagaagattttcaaaccagaagaattacgacaggctctgatgccaacattg
gaggcactttaccggcaggatccagaatcccttccctttcgtcagcctgtagacccacag
cttctaggaatccctgattactttgatattgtgaagagtcccatggatctctctactatc
aagaggaagttagatactggacaataccaagagccctggcaatatatagacgacatttgg
cttatgttcaacaatgcctggttatataaccgcaaaacttcaagggtatacaaatattgc
tccaaactctccgaggtgtttgaacaagaaatcgacccagtcatgcaaagccttggatat
tgttgtggcagaaagttggagttctctccacagacactgtgttgctatggcaaacagtta
tgcacaatcccacgagatgctacttattacagttaccagaacaggtatcatttctgtgag
aagtgtttcaatgaaatccaaggggagagcgtttctttgggggatgacccttcccagcct
caaactacaataaataaagaacagttttccaagagaaaaaatgacacgctagatcctgaa
ctgtttgttgaatgcacagaatgtggaagaaagatgcaccagatctgtgttcttcaccat
gagatcatctggccatctgggtttgtctgtgatggctgtttaaagaaaactgcacgtact
aggaaagaaaataagttttctgctaaaagattgccatctaccagacttggtacctttctg
gagaatcgagtgaatgactttctaaggcgacaaaatcaccctgaatcaggagaggtcact
gttagggttgttcatgcttctgacaaaactgtggaagtgaaaccaggcatgaaagcaagg
tttgtagatagtggagaaatggcagaatcttttccataccgaaccaaggccctttttgcc
tttgaagaaattgatggtgttgacttgtgtttctttggcatgcatgttcaagagtatggc
tctgactgccccccacccaaccaaaggagagtgtacatatcttacctcgatagtgttcat
ttcttccgtcctaaatgcttgaggactgcagtctatcatgaaattttaattggatactta
gaatatgtcaagaaattgggatacacaacagggcatatttgggcatgtccaccaagtgaa
ggggatgactatatcttccattgtcatccgcctgatcagaagatcccaaagcccaagcgc
ctacaggaatggtacaaaaagatgcttgacaaggctgtgtcagaacgtattgtccatgac
tacaaggatattttaaaacaagctactgaagatcgattaacaagtgcaaaggagttaccc
tactttgaaggtgatttctggcccaatgttctggaagagagcattaaagaacttgaacag
gaagaggaagagagaaaacgggaagaaaacactagcaatgagagtactgatgtaacaaaa
ggagatagcaaaaatgctaagaagaagaataacaagaaaaccagcaaaaacaagagcagc
ctgagtaggggcaataagaagaagcctggtatgcccaatgtgtctaatgacctgtctcag
aaactgtatgccaccatggaaaagcataaagaggtcttctttgtaatccgcctcatcgct
tgtcctgctcccaattccttgcctcccattgttgaccctgaccctctcatcccctgtgac
ctgatggatggtagagatgcattcctcacccttgcaagggataagcacctggaattctcc
tcacttcgaagagcccagtggtctaccatgtgcatgctggtggagctgcacacacagagt
caagatcggtttgtctatacctgcaacgagtgcaagcaccatgtggagacacgctggcat
tgcactgtatgtgaggattatgacctgtgtattacctgttataacactaaaaatcatgac
cacaaaatggagaaactaggccttggcttggatgatgagagcaacaaccagcaagcagca
gccacacagagcccaggagactctcgacgcctgagcatccagcgatgcatacagtctctg
gtacatgcctgccagtgccgcaatgccaattgttccctgccttcctgccagaagatgaag
agggttgtacagcacaccaaaggctgtaaacggaaaaccaatggtggatgccccatctgc
aaacagcttattgccctctgctgctaccatgccaagcactgccaggagaacaaatgcccg
gtgccattctgcctcaacattaagcaaaagctcagacagcaacagctgcagcaccggctc
caacaggctcagatgctccgcaggaggatggccagcatgcaacggactggtgtggcgggg
cagcagcagggcctgccttccccaactcctgctactccaaccaccccaactggccaacag
ccagcaaccccacagacaccccagccccaacccacctctcaaccacagcccactcctccc
aacaacatgccaccctacttgcccaggactcaaactgccggccctgtttcccagggtaag
gcagcgggtcaagtaactccaccaaccccacctcagactgctcagccttcccttccaggg
cctccacctgcagcagtagaaatggcaatgcagattcagagggcagcagagacacagcgc
cagatggctcatgtacaaattttccaaaggccaattcagcaccaaatgccccagatggca
cccatggcccctatgggcatgaacccacctcccatggccagaggtcctggtgggcatttg
gaaccaggaatgggtcccacaggaatgcaacagcagccaccttgggcccaaggaggaatg
cctcagccacagcagatgcagtcagggatgccaaggcctgccatgatgtcagtggcccag
catggtcagcccttgaacatggctccacagccaggattgggccaagtaggtgtgagccct
ctcaaaccaggcactgtgtctcaacaagccttacaaaaccttttgcggactctcaggtct
cccagttctcccttacagcagcaacaggtgcttagtatccttcacgccaacccccaactg
ttggctgcatttatcaagcagcgggctgccaaatatgccaactctaatccacaacctctc
cctggacagcctggcatgccccagggtcagccagggctacagccacctaccatgcctggt
cagcaaggtgtccactccaacccagccttgcagaacatgaatcctatgcaggcaggtgtc
cagagagctggcctgccccaacagcagccccaacagcagctccagccacccatgggagga
atgagcccccaggctcagcagatgaacatgaatcacaatgccatgccgtcacagttccga
gacattttaagacgtcagatgatgcaacagcagggagcagggccaggaattggcccaggc
atggccaaccacaaccagttccagcagccccaaggaattggatacccaccccagcagcaa
cagcagcaacagcagcggatgcagcatcacatgcaacagatgcagcaagggaatatggga
cagatggcccagctcccccaggctttgggggcagaggcaggagccagtctgcaggcctat
cagcagcgccttcttcagcaacagatggggtctcctgctcagcccaaccctatgagtcca
cagcagcatatgctcccaaatcaggcacagtccccacacctgcaaggtcagcagatccct
aattctctctccaatcaagtacgttctccccagcctgtcccttctccgcgaccacagtct
caacccccccattccagcccatctccgaggatgcagcctcagccttctccacaccatgtt
tctccacagaccagttccccacatcctggactggtagctgcccaggctgccaaccccatg
gaacaagggcattttgccagcccagaccagaattcaatgctttcacagctcactagcaat
ccaggcatggcaaacctccacggtgcaagcgccacggacctgggactgagcaccgataat
gcagacttgaattcaaacctctcacagagtacactagacatacactag

KEGG   Cricetulus griseus (Chinese hamster): 100770451
Entry
100770451         CDS       T02813                                 

Definition
(RefSeq) histone lysine acetyltransferase CREBBP isoform X3
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04024  cAMP signaling pathway
cge04066  HIF-1 signaling pathway
cge04068  FoxO signaling pathway
cge04110  Cell cycle
cge04310  Wnt signaling pathway
cge04330  Notch signaling pathway
cge04350  TGF-beta signaling pathway
cge04520  Adherens junction
cge04630  JAK-STAT signaling pathway
cge04720  Long-term potentiation
cge04916  Melanogenesis
cge04919  Thyroid hormone signaling pathway
cge04922  Glucagon signaling pathway
cge04935  Growth hormone synthesis, secretion and action
cge05016  Huntington disease
cge05152  Tuberculosis
cge05161  Hepatitis B
cge05164  Influenza A
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05206  MicroRNAs in cancer
cge05211  Renal cell carcinoma
cge05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100770451
   04330 Notch signaling pathway
    100770451
   04350 TGF-beta signaling pathway
    100770451
   04630 JAK-STAT signaling pathway
    100770451
   04066 HIF-1 signaling pathway
    100770451
   04068 FoxO signaling pathway
    100770451
   04024 cAMP signaling pathway
    100770451
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100770451
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100770451
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100770451
   04935 Growth hormone synthesis, secretion and action
    100770451
   04919 Thyroid hormone signaling pathway
    100770451
   04916 Melanogenesis
    100770451
  09156 Nervous system
   04720 Long-term potentiation
    100770451
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100770451
   05206 MicroRNAs in cancer
    100770451
   05203 Viral carcinogenesis
    100770451
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100770451
   05215 Prostate cancer
    100770451
  09164 Neurodegenerative disease
   05016 Huntington disease
    100770451
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100770451
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100770451
   05161 Hepatitis B
    100770451
   05164 Influenza A
    100770451
   05167 Kaposi sarcoma-associated herpesvirus infection
    100770451
   05165 Human papillomavirus infection
    100770451
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cge03000]
    100770451
   03036 Chromosome and associated proteins [BR:cge03036]
    100770451
   03029 Mitochondrial biogenesis [BR:cge03029]
    100770451
Enzymes [BR:cge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100770451
Transcription factors [BR:cge03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    100770451
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100770451
Mitochondrial biogenesis [BR:cge03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100770451
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 100770451
NCBI-ProteinID: XP_027279825
LinkDB
Position
7
AA seq 2440 aa
MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGELNILNSGSLVP
DAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLGGQQAQGQPNSTNMASLGAMGK
SPLNQGDSSTPSLPKQAASTSGPTPPASQALNAQAQKQVGLVTSSPATSQTGPGICMNAN
FNQTHPGLLNSNSGHSLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPAPAMQGATSSVLA
ETLTQVSPQMASHAGLNTAQAGGMTKMGMTGNTSPFGQPFSQTGGQQMGATGVNPQLSSK
QSMVNSLPAFPTDIKNTSVTSVPNMSQLQSSVGIVPTQAIATGPTADPEKRKLIQQQLVL
LLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWK
NCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGAGQQNATSLSNPNPIDPSS
MQRAYAALGLPYMNQPQTQLQPQVPGQQPAQPPAHQQMRTLNALGNNPMSIPAGGITTDQ
QPPNLISESALPTSLGATNPLMNDGSNSGNIGSLSTIPTAAPPSSTGVRKSWHEHVTQDL
RSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYK
IQKELEEKRRSRLHKQGILGNQPALPAPGAQPPVIPPTQSVRPPNGPLPLPVNRMQVSQG
MNSFNPMSLGNVQLPQAPMGPRAASPMNHSVQMNSMASVPGMAISPSRMPQPPNMMSTHA
NNMMAQAPTQNQFLPQNQFPSTSGAMSVNSVSMGQPAAQTGVSQGQVPGGALPNPLNMLA
PQASQLPCPPVTQSPLHPTPPPASTAAGMPSLQHPTPPGMTPPQPAAPTQPSTPVSSGQT
PTPTPGSVPSAAQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHTQPPG
TPLSQAAASIDNRVPTPSSVTSAETGSQQPGPEVPMLEMKTEVQTDDAEPDPGESKGEPR
SEMMEEDLQGSSQVKEETDTAEQKSEPMEVEEKKPEVKVETKEEEESSANGTASQSTSPS
QPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTI
KRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGY
CCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQP
QTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRP
RKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSR
FVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIH
FFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKR
LQEWYKKMLDKAFAERIINDYKDIFKQANEDRLTSAKELPYFEGDFWPNVLEESIKELEQ
EEEERKKEESTAASETPEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLS
QKLYATMEKHKEVFFVIHLHAGPVISTQPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEF
SSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSH
THKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKM
KRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHR
LQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVNMSP
AGFPNVARTQPPTIVSAGKPTNQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRANIN
NGMPPGRAGMGTPGSQMAPVGLNVPRPNQVSGPVMSSMPPGQWQQAPIPQQQPMPGMPRP
VMSMQAQAAVAGPRMPNVQPPRSISPSALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMA
AFIKQRTAKYVANQPGMQPQPGLQSQPGMQPQPGMHQQPSLQNLNAMQAGVPRPGVPPQQ
QAMGGLNPQGQALNIMNPGHNPNMANMNPQYREMVRRQLLQHQQQQQQQQQQQQQSSASM
AGGMAGHGQFQQPQGPGGYAPAMQQQRMQQHLPIQGSSMGQMAAPMGQLGQMGQPGLGAD
STPSIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQIATSLSNQ
VRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSMDQGHLGN
PEQSAMLPQLNTPNRSALSSELSLVGDTTGDTLEKFVEGL
NT seq 7323 nt   +upstreamnt  +downstreamnt
atggccgagaacttgctggacggaccgcccaaccccaaacgagccaaactcagctccccg
ggcttctccgcgaatgacagcacagattttggatcattgtttgacttggaaaatgatctt
cctgatgagctgattcctaatggagaattaaacattttaaacagtgggagccttgttcca
gatgctgcatccaaacataaacaactatcggaacttcttagaggaggcagcggctctagc
atcaacccagggataggaaatgtgagtgccagcagccctgtgcaacagggccttggtggc
cagcaggctcaggggcagccgaacagtacaaacatggccagcctgggtgccatgggcaag
agccctctgaaccagggagactcatcaacccctagcctgcccaaacaggcagccagcacc
tctgggcccacccccccagcctcccaagcactgaatgcacaagcacaaaagcaagtgggg
ctggtgaccagtagccctgccacatcacagactggacctggaatctgcatgaatgctaac
ttcaaccagacccacccaggccttctcaatagtaactctggccatagcttaatgaatcag
gctcaacaagggcaggctcaagtcatgaatggatcacttggggctgctggaagaggaagg
ggagctggaatgccctaccctgctccagctatgcagggagccacaagcagtgttctggct
gagaccttgacacaggtttccccacaaatggctagccatgctggactgaacacggcacag
gcaggaggcatgaccaagatgggaatgactggtaacacaagtccatttggacaacccttt
agtcaaactggagggcagcagatgggagccactggagtgaatccccagttatccagcaaa
cagagcatggtcaatagtttgcctgcttttcctacagatatcaagaatacatcagtcacc
agtgtgccaaatatgtcccagttgcaatcatcagtgggaattgttcccacacaagcaatt
gcaacaggccccacagcagatcctgaaaagcgcaaactgatacagcagcagctggttcta
ctgcttcacgcccacaaatgccagagacgagagcaagcgaatggagaggtgcgggcctgc
tctctccctcactgtcgaaccatgaaaaatgttttgaaccacatgacgcattgtcaggcc
gggaaagcctgccaagttgcccattgtgcatcttcacgacaaatcatctctcattggaag
aactgcacacgacatgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcga
aaccaacaaaccatcctgggatctccagctagtggaattcaaaacacaattggttctgtt
ggtgcagggcaacagaatgccacttctttaagtaacccaaatcctatagaccccagttcc
atgcagcgggcctatgctgctctaggactcccctacatgaaccagccccagacacagctg
cagcctcaggttcctggccagcaaccagcgcagcctccagcccaccagcagatgaggact
ctcaatgccctaggaaacaaccccatgagtattccagcaggtggaataacaacagatcag
cagccaccaaacttgatttcagaatcagctcttccaacatccttgggggccaccaatcca
ctaatgaatgatggctcgaactctggtaacattggaagcctcagcacgatacctactgca
gcacctccttccagcaccggtgttcgaaaaagctggcatgaacatgtgactcaggacctg
aggagccatctagtgcataaacttgtccaagccatcttcccaactcctgatcctgcagct
ctgaaggatcgccgaatggagaacctggtcgcctatgctaagaaagtagagggggacatg
tatgagtctgctaacagcagggatgagtactaccatttattagcagagaaaatctataaa
atacaaaaagaactagaagaaaaacggaggtcacgtttacataagcaaggcatcttgggt
aaccagccagctttgccagctcctggggctcagccccctgtgattccaccaactcagtct
gtgagacctccaaatgggccactgcctctgccagtgaatcgaatgcaggtttctcaaggg
atgaattcatttaacccaatgtcccttggaaatgtccagttgccacaagctccaatggga
cctcgtgcagcctcccccatgaaccactctgtccagatgaacagcatggcctcagttcca
ggtatggccatttctccttcccggatgcctcagcctccaaacatgatgagcacccatgcc
aacaacatgatggctcaggcacccactcagaaccagtttctgccacagaaccagttccca
tcaaccagtggggcaatgagtgtgaacagtgtcagtatggggcagccagcagcccagaca
ggcgtttcacagggccaggtgcctggtggtgctcttcctaatcctttgaacatgctggca
ccccaggccagccagctgccctgcccaccagtgacacaatcaccgttgcacccaactcct
cctcctgcttccacagctgctggcatgccctctctccaacatccaacaccacctgggatg
acacctccccagccagcagctcccactcagccatctactcctgtgtcatccgggcagacc
cctaccccaactcctggctcagtgcccagtgctgcccaaacacagagtacccctacggtc
caagcagcagcacaggcccaggtgactccacagcctcaaaccccagtgcagccaccatct
gtggctaccccccagtcatcacagcagcaaccaacacctgtgcacactcagcctcctggc
acaccgctctctcaggcagcagccagcattgataatagggtccccactccctcctctgtg
accagtgctgaaaccggttcccagcagccaggacctgaggtacccatgctggaaatgaag
acagaagttcagacagatgatgctgagcctgatcctggtgaatccaagggggaacctcgg
tctgagatgatggaagaggatttacaagggtcttcccaagtaaaagaagaaacagacaca
gcagagcagaagtcagaaccaatggaagtagaagaaaagaaacccgaagtaaaagtggaa
actaaagaggaagaggaaagcagtgctaatggcacagcctcacagtcaacatccccttcc
cagccacgcaaaaaaatctttaaacccgaggagctacgccaggcacttatgccaactcta
gaagcactctacagacaggacccagagtctttaccttttcggcaacctgtagatccccag
ctcctaggaatcccagattattttgatattgtgaagaatcctatggacctttctaccatc
aaacggaagctggatacagggcagtaccaagaaccctggcagtatgtggatgatgtctgg
cttatgttcaacaatgcttggctatataatcgaaagacatcccgggtgtataaattttgc
agtaaacttgcagaagtctttgagcaagaaattgaccctgttatgcagtctctcggatat
tgctgtggacgaaagtatgagttttccccacagactttgtgctgttatgggaagcagctg
tgcacaattcctcgcgatgcagcctactacagctatcagaataggtatcatttctgtgag
aagtgtttcacagagatccagggcgagaatgtgaccctgggtgacgacccttcccaacct
cagacgacgatttccaaggatcagtttgaaaagaagaaaaatgataccttagatcctgaa
ccttttgttgactgcaaagagtgtggccggaagatgcatcagatttgcgttctacactat
gacatcatttggccttcaggttttgtgtgtgacaactgcttgaagaaaactggcagacct
cggaaagaaaacaaattcagtgctaagaggcttcagaccacacgattgggaaaccacttg
gaagaccgtgtgaataagtttttgcggcgccagaatcaccctgaggctggggaggttttt
gtcagagtggtggccagctcagacaagacggtggaggtcaagccagggatgaagtcaagg
tttgtggattctggagaaatgtcagaatctttcccgtatcgaaccaaagcactctttgct
ttcgaggagattgatggagtcgatgtttgcttttttgggatgcatgtgcaagagtatggc
tctgattgccccccgccaaatacaaggcgtgtgtacatatcttatctggacagtattcat
ttcttccggccccgctgcctccggacagctgtttaccatgagatcctcattggatatcta
gagtatgtgaagaaattggggtatgtgacaggacacatctgggcctgtcccccaagtgaa
ggagatgactacatctttcattgccacccacctgatcagaaaatccccaaacccaaaaga
ctacaggagtggtacaagaagatgctggacaaggcatttgcagagaggatcattaatgac
tataaggacatcttcaaacaagcaaatgaagacaggctcacgagtgccaaggagttgccc
tattttgagggagatttctggcctaatgtgttggaagaaagcattaaggagctagaacaa
gaagaagaagagaggaaaaaagaagagagtactgcagctagtgaaacccctgagggcagt
caaggtgacagcaagaatgccaagaaaaagaacaataaaaaaaccaacaaaaacaaaagc
agcattagccgagccaacaagaagaagcccagcatgcccaatgtgtccaacgacctgtcc
cagaagctgtatgccaccatggagaaacataaggaggtcttctttgtgattcatctgcat
gctgggcctgttatcagcactcagccccccatcgtggaccctgaccccctgctcagctgt
gacctcatggatgggcgtgatgccttcctcaccctggctagagacaagcactgggagttc
tcttccttacgccgctccaaatggtccactctgtgcatgctggtggaactgcacacacag
ggccaggaccgctttgtctatacctgcaatgagtgcaaacaccatgtagagacacgctgg
cactgcactgtgtgtgaggactatgacctttgtatcaattgctacaacacaaagagccac
acccataaaatggtgaagtggggactgggcctagacgatgagggcagcagtcaaggtgag
ccacagtccaagagcccccaggagtcccggcgtctcagcatccaacgctgcatccagtcc
ctggtccatgcctgccagtgtcgcaatgccaactgctctctgccatcttgccagaagatg
aaacgagtagtgcagcacaccaagggttgtaaacgcaagactaatggaggatgccccgta
tgcaagcagctcattgctctttgctgctaccacgccaaacactgccaagaaaataaatgc
cctgtgcccttctgcctcaacatcaaacacaagctccgccagcagcagatccagcatcgc
ctgcagcaggcccagctcatgcgccgtcgaatggccaccatgaacacccgcaatgtgcct
cagcagagtttgccttctcctacctcagcaccacctgggacccccacacagcagcccagc
acaccccaaacaccacagccccctgcccagcctcagccttcacctgtaaacatgtcacca
gctggcttccctaatgtagcccggactcagcccccaacgatagtgtctgctgggaagcct
accaaccaggtgccagctcccccacctcctgcccagcccccacctgcggcagtagaagca
gcaaggcaaattgaacgtgaggcccagcagcagcagcatctgtaccgagcaaacatcaac
aatggcatgcccccagggcgtgcaggtatgggaaccccagggagccagatggcccctgtg
ggcctgaatgtgccccgtcccaaccaagtcagtgggcctgtcatgtctagcatgccacct
gggcaatggcagcaggcacccatcccccagcagcagccaatgccaggcatgcccaggcct
gtgatgtctatgcaggcccaggcagcagtggctgggccacggatgcccaatgtgcagcca
ccaaggagcatctcgccaagtgccctgcaagacctgcttcggaccctgaagtcgcccagc
tcccctcagcagcagcagcaggtgctgaacatcctcaaatcaaacccacagctaatggca
gctttcattaaacagcgcacagccaagtatgtggccaatcagcctggcatgcagccccag
cctggacttcagtcccagcctggtatgcagccccagcccggcatgcaccagcagcccagc
ctgcagaacctgaatgcaatgcaagctggtgtgccacggcctggtgtgcctccacagcaa
caggcgatgggaggcctgaatccccagggacaggctctgaacatcatgaaccctggacac
aaccccaacatggcaaacatgaatccacagtaccgagaaatggttaggagacagctgcta
cagcaccaacagcagcagcagcaacagcagcaacagcagcaacaaagcagtgccagcatg
gccgggggcatggcaggacatggccagttccagcagccacaaggacctggaggctacgcc
ccagccatgcagcagcaacgtatgcaacagcacctccccatccagggtagctccatgggc
cagatggctgctccaatgggacaacttggccaaatggggcagcctgggctgggggcagac
agcacccccagcattcagcaggccctacagcagcggattctgcagcagcagcagatgaag
cagcagattgggtccccaggccagccgaaccccatgagcccccagcagcacatgctctca
ggacagccacaggcctcgcatctccccggccagcagatcgccacatcccttagtaaccag
gtgcggtctccagcccctgtccagtctccacggccccaatcccagcctccacattccagc
ccatcaccacggatacagccccagccttcaccacaccatgtttcaccccagactggctcc
ccccaccccggactcgcagtcaccatggccagctccatggatcagggacacctggggaac
cccgaacagagtgcaatgctcccccagctgaatacccccaacaggagcgcgctgtccagt
gaactgtccctggttggtgataccacgggagacacactagaaaaatttgtggagggtttg
tag

DBGET integrated database retrieval system