KEGG   Cricetulus griseus (Chinese hamster): 100762526Help
Entry
100762526         CDS       T02813                                 

Definition
(RefSeq) anionic trypsin-2
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04080  Neuroactive ligand-receptor interaction
cge04972  Pancreatic secretion
cge04974  Protein digestion and absorption
cge05164  Influenza A
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100762526
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    100762526
   04974 Protein digestion and absorption
    100762526
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    100762526
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cge01002]
    100762526
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100762526
Enzymes [BR:cge01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     100762526
Peptidases [BR:cge01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100762526
Exosome [BR:cge04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100762526
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 100762526
NCBI-ProteinID: XP_003504431
LinkDB All DBs
Position
Un
AA seq 245 aa AA seqDB search
MSALLILALVGAAVAFPIDDDKIVGGYTCQKNSVPYQVSLNSGYHFCGGSLINNQWVVSA
AHCYKTRIQVRLGEHNINVLEGDEQFVTASKIIRHPSFNSRTLDNDIMLIKLASPVTLNS
RVATVALPTSCAAAGTQCLISGWGNTLSSGVNNPDLLQCLNAPVLSQSACQAAYPGQITA
NMICVGFLEGGKDSCQGDSGGPVVCNGKLQGIVSWGYGCALKNNPGVYTKVCNYVSWIQS
TIAAN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctctcctgatcctggcccttgtgggggcagctgttgcttttcctattgatgat
gacaagatcgtcggaggatatacttgccagaagaattctgtcccctaccaggtgtctctg
aactctggctaccacttctgtggaggctccctcatcaataaccaatgggtggtgtctgca
gctcattgctacaagacccgcatccaagtgagacttggagagcacaacatcaatgtcctt
gagggggatgagcagtttgtcactgcttccaagatcatcaggcaccccagctttaactca
aggaccctggacaatgacatcatgctgatcaagctggcctcccctgtgaccctcaattcc
cgggtggccactgtcgctctgcccacctcttgtgcagctgctggcactcagtgcctcatt
tctggctggggcaacaccctcagctctggtgtaaataacccagacctgctccagtgcctg
aatgctccagtgctgtctcagtctgcctgtcaagccgcctatcctggacagatcactgct
aacatgatctgtgttggcttccttgagggaggcaaggattcctgccagggtgactctggt
ggtcccgtggtctgcaatggaaaactccagggcatcgtctcctggggctatggctgtgcc
ttgaaaaataatcctggtgtgtacaccaaggtctgcaattatgtgagctggattcagagc
acaattgctgccaactaa

DBGET integrated database retrieval system