KEGG   Cricetulus griseus (Chinese hamster): 100762587
Entry
100762587         CDS       T02813                                 

Gene name
Dvl2
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-2 isoform X2
  KO
K02353  segment polarity protein dishevelled
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04150  mTOR signaling pathway
cge04310  Wnt signaling pathway
cge04330  Notch signaling pathway
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04916  Melanogenesis
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100762587 (Dvl2)
   04330 Notch signaling pathway
    100762587 (Dvl2)
   04390 Hippo signaling pathway
    100762587 (Dvl2)
   04150 mTOR signaling pathway
    100762587 (Dvl2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100762587 (Dvl2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100762587 (Dvl2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100762587 (Dvl2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100762587 (Dvl2)
   05226 Gastric cancer
    100762587 (Dvl2)
   05217 Basal cell carcinoma
    100762587 (Dvl2)
   05224 Breast cancer
    100762587 (Dvl2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100762587 (Dvl2)
   05022 Pathways of neurodegeneration - multiple diseases
    100762587 (Dvl2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100762587 (Dvl2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100762587 (Dvl2)
SSDB
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 100762587
NCBI-ProteinID: XP_027282762
LinkDB
Position
7
AA seq 736 aa
MAGSSAGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSM
DQDFGVVKEEISDDNARLPCFNGRVVSWLVSSDNPQPEMAPPAHESRTELVPPPPPLPPL
PPERTSGIGDSRPPSFHPNVSSSHENLEPETETESVVSLRRERTRRRDSSEHGAGGHRPS
GTSRLERHLAGYESSSTLMTSELESTSLGDSDEDDTMSRFSSSTEQSSASRLLKRHRRRR
KQRPPRMERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIM
KGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQ
AYFTLPRNEPIQPIDPAAWVSHSAALTGTFPAYPGSSSMSTITSGSSLPDGCESRGLSIH
MDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYAS
GLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPLP
GATPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGG
AGRTGRPEERAPESKSGSGSESELSSRGGSLRRGGEPSGTGDGGPPPSRGSTGGTPNLRA
LPGLHPYGPPPGMALPYNPMMVVMMPPPPPPVSTAVQPPGAPPVRDLGSVPPELTASRQS
FHMAMGNPSEFFVDVM
NT seq 2211 nt   +upstreamnt  +downstreamnt
atggcgggcagcagcgcggggggcggtggtgtaggcgagacgaaggtgatttaccatctg
gatgaggaagagactccctacctggtgaagattcctgtcccggcggagcgcatcaccctc
ggcgatttcaagagcgttttgcagcggcccgcgggcgctaagtactttttcaagtctatg
gatcaggattttggggtggtgaaggaagagatttcagatgacaatgcccgcctaccttgc
ttcaatggaagggttgtctcctggctagtgtcatcagataacccccagcctgagatggct
cccccagcccatgagtctcggacagaactggttcctccacctccaccattaccgcctttg
cctccagaaagaaccagtggtattggggactcaagacctccatccttccaccccaatgtg
tccagcagccatgaaaatctagagcctgagacagaaactgagtctgttgtatcactgaga
cgagaacgaactcgaaggagagacagcagtgagcatggcgctggtggccacaggcccagt
ggcacctcaaggctggagcgccacctggctgggtacgagagttcttccaccctcatgacc
agtgagctggagagtaccagcctaggagactctgatgaggatgacaccatgagtagattc
agcagttccactgagcagagcagtgcctcccgcctcctcaagcgccaccgaaggcggaga
aagcagcggccaccacgcatggaaaggacctcatcctttagcagtgtcaccgattccaca
atgtctctcaacatcatcacagttacactcaacatggagaagtacaacttcctgggcatc
tccattgtgggccaaagtaatgagcggggtgacggaggcatctacatcggctccatcatg
aaggggggcgctgtggctgctgatgggcgcatagagcctggagacatgcttttgcaggtg
aatgatatgaactttgagaacatgagcaatgatgacgctgtacgggtactgagagacatt
gtgcacaaaccaggccccatcgtgctgaccgtggccaagtgctgggatccctctccccag
gcctacttcaccctcccccgaaatgagcccatccagccaattgatcccgctgcctgggtg
tcacactccgctgctctgactggcaccttccctgcttatccgggctcttcatctatgagc
actattacatctggctcgtccctgcctgatggctgtgaaagccggggtctctctatccac
atggacatggcctctgtgaccaaggccatggcagctccagaatctgggctagaagttcgg
gaccgcatgtggctcaagatcaccatcccaaatgcctttctaggctcagatgtggtagac
tggctgtaccatcatgtggaaggctttcctgagcgccgggaggcccggaagtatgccagt
ggactattgaaggcgggactcatccgacacactgtcaacaagattactttttctgagcag
tgctattatgtcttcggggacctcagtggtggctgtgaaagttacctagttaacctgtct
ctgaacgacaatgatggttccagtggggcttctgaccaggataccctggctcctcttcct
ggagctaccccctggcccctgctgcctaccttctcctaccagtacccagccccacaccca
tacagcccacagcctccaccctaccacgagctttcatcctatacttacggtggaggcagt
gccagcagccagcacagtgaagggagccggagcagtgggtcaacaagaagtgatgggggg
gccgggcgcacagggaggcctgaggaacgggcccctgagtcaaagtctggcagtggcagt
gagtccgagctttccagccggggaggcagccttcggcggggtggggaacccagtgggact
ggtgatgggggtccccctccatccaggggctcaacaggcggtactcctaatctccgagct
cttccagggctccatccctatggacctccccctggcatggctctcccctataatcccatg
atggtagtcatgatgcctccacccccaccccctgtctctactgcagtgcagccccctggt
gctcctccagttagagacctgggctctgtgcccccagaactgacagctagccgtcagagc
ttccacatggccatgggcaaccccagtgaattttttgtagatgttatgtag

KEGG   Cricetulus griseus (Chinese hamster): 100770288
Entry
100770288         CDS       T02813                                 

Gene name
Dvl1
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-1 isoform X4
  KO
K02353  segment polarity protein dishevelled
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04150  mTOR signaling pathway
cge04310  Wnt signaling pathway
cge04330  Notch signaling pathway
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04916  Melanogenesis
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100770288 (Dvl1)
   04330 Notch signaling pathway
    100770288 (Dvl1)
   04390 Hippo signaling pathway
    100770288 (Dvl1)
   04150 mTOR signaling pathway
    100770288 (Dvl1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100770288 (Dvl1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100770288 (Dvl1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100770288 (Dvl1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100770288 (Dvl1)
   05226 Gastric cancer
    100770288 (Dvl1)
   05217 Basal cell carcinoma
    100770288 (Dvl1)
   05224 Breast cancer
    100770288 (Dvl1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100770288 (Dvl1)
   05022 Pathways of neurodegeneration - multiple diseases
    100770288 (Dvl1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100770288 (Dvl1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100770288 (Dvl1)
SSDB
Motif
Pfam: Dishevelled Dsh_C DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 100770288
NCBI-ProteinID: XP_027254385
UniProt: G3I423 A0A061IIR0
LinkDB
Position
2
AA seq 695 aa
MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVK
EEIFDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDSHTDLPPPLERTGGIGDSRPPSF
HPNVASSRDGMDNETGTESMVSHRRERARRRNRDEASRTNGHPRGDRRRDLGLPPDSAST
VLSSELESSSFIDSDEEDNTSRLSSSTEQSTSSRLIRKHKCRRRKQRLRQTDRASSFSSI
TDSTMSLNIITVTLNMERHHFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPGDM
LLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTIPRADPVRPIDP
AAWLSHTAALTGALPRYGTSPCSSAITRTSSSSLTSSVPGAPQLEEAPLTVKSDMSAIVR
VMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHVEGFRERREARKYASSMLKRGFL
RHTVNKITFSEQCYYVFGDLCTNLASLNLNSGSSGASDQDTLAPLPHPSVPWPLGQGYPY
QYPGPPPCFPPAYQDPGFSYGSGSAGSQQSEGSKSSGSTRSSHRTPGREERRAAGAGGSG
SESDHTAPSGSGSTGWWERPVSQLSHGSSPRSQASAVAPGLPPLHPLTKAYAVVGGPPGG
PPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDIM
NT seq 2088 nt   +upstreamnt  +downstreamnt
atggcggagaccaagatcatctaccacatggacgaggaggagacgccgtacctggtcaag
ctgccggtagctcccgaacgcgtcacgctggcggacttcaagaacgtgctcagcaaccgg
ccggtgcacgcctacaaattcttcttcaagtctatggaccaggacttcggggtggtgaag
gaggagatcttcgatgacaatgccaagttgccctgcttcaatggccgggtggtttcctgg
ctggtcctggctgagggcgctcactcggacgcagggtcccagggcactgacagccacacg
gacctgcccccaccccttgagaggacaggcggcattggggactccaggcccccctccttc
catccaaatgttgccagtagccgtgatggaatggacaatgagacaggcacagagtccatg
gtcagtcaccggcgggagcgagcccgacgtcgaaaccgtgatgaggcttcccggaccaat
gggcacccgaggggagaccggcgacgggatctgggactgcctccagacagtgcatccact
gtgttgagcagtgagcttgaatctagcagctttattgactcagatgaggaggataacaca
agccggctgagcagttctacagagcagagcacctcctctcggctaattcgtaagcacaaa
tgtcgtcgtcggaagcagcgcttgaggcagacagaccgggcatcctccttcagcagcatc
accgactccaccatgtccctgaacatcatcaccgtcactctcaacatggagaggcaccac
ttcctgggcatcagcatcgtgggccagagcaacgaccggggtgatggcggcatctacatt
ggatccatcatgaagggcggagctgtggctgctgatggccgcattgagccaggcgacatg
ctgctgcaggtcaatgatgtcaactttgagaacatgagcaacgatgacgctgtgcgggtg
cttcgggagatcgtatcccaaacggggcccatcagcctcacagtggccaagtgctgggac
ccaacccctcggagctactttaccatcccaagggctgacccagtgcgacccatcgacccg
gctgcctggctgtcccacacagcagcgctgacgggtgctctgccccgctatggtacgagt
ccctgctccagtgccatcacacgcaccagctcttcctcactaaccagctcagtgcctggc
gccccacagcttgaggaggcaccactgacagtgaagagtgacatgagcgccattgtccgg
gtcatgcagttgccagactcaggactggagattcgggaccgcatgtggcttaagatcacc
attgccaatgctgtcattggggcggatgtggtggactggctgtacacgcatgtggagggc
ttcagagagcgaagagaggcgaggaagtatgccagcagtatgctgaagcgcggcttcttg
aggcacaccgtcaacaagatcaccttctctgagcagtgctactatgtctttggggacctg
tgcactaaccttgcatccctgaacctcaacagtggctccagtggagcctcagatcaggac
acactggcccccctgccccacccatctgtaccctggcccttgggtcaaggctacccctac
cagtacccagggcccccgccctgcttcccacctgcttaccaggaccctggcttcagctat
ggcagtggcagtgctgggagtcagcagagtgaagggagcaagagcagtgggtccacaagg
agcagccatcggaccccaggccgagaggagcgccgggcagctggagctgggggcagtggc
agcgaatcagatcacacggcaccaagtgggtctggtagcactggctggtgggagcgtcca
gtcagccagcttagccatggcagtagccctagaagtcaggcgtcagctgttgccccaggt
ctccccccactgcaccccctgacaaaggcctatgcagtagtgggtgggccacctggaggg
ccacctgtccgggagctggctgctgttcctccggaacttacaggtagccgccagtccttc
caaaaggctatgggaaatccctgtgagttctttgtggacattatgtga

KEGG   Cricetulus griseus (Chinese hamster): 100773535
Entry
100773535         CDS       T02813                                 

Gene name
Dvl3
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-3 isoform X2
  KO
K02353  segment polarity protein dishevelled
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04150  mTOR signaling pathway
cge04310  Wnt signaling pathway
cge04330  Notch signaling pathway
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04916  Melanogenesis
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100773535 (Dvl3)
   04330 Notch signaling pathway
    100773535 (Dvl3)
   04390 Hippo signaling pathway
    100773535 (Dvl3)
   04150 mTOR signaling pathway
    100773535 (Dvl3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100773535 (Dvl3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100773535 (Dvl3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100773535 (Dvl3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100773535 (Dvl3)
   05226 Gastric cancer
    100773535 (Dvl3)
   05217 Basal cell carcinoma
    100773535 (Dvl3)
   05224 Breast cancer
    100773535 (Dvl3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100773535 (Dvl3)
   05022 Pathways of neurodegeneration - multiple diseases
    100773535 (Dvl3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100773535 (Dvl3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100773535 (Dvl3)
SSDB
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 100773535
NCBI-ProteinID: XP_027268865
LinkDB
Position
4
AA seq 716 aa
MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEI
SDDNAKLPCFNGRVVSWLVSAEGSHPEPAPFCADNPSELPPSMERTGGIGDSRPPSFHPH
ASGGSQENLDNDTETDSLVSAQRERPRRRDGPEHAARLNGTAKGERRREPGGYDSSSTLM
SSELETTSFFDSDEDDSTSRFSSSTEQSSASRLMRRHKRRRRKQKVSRIERSSSFSSITD
STMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLL
QVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRSEPIRPIDPAA
WVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTERLDDFHLSIHSDMAAIVKAMA
SPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHNVEGFTDRREARKYASNLLKAGFIRHT
VNKITFSEQCYYIFGDLCGNMANLSLHDHDGSSGASDQDTLAPLPHPGAAPWPMAFPYQY
PPPPHPYNPHPGFPELGYSYGGGSASSQHSEGSRSSGSNRSGSDRRKEKDPKAGDSKSGG
SGSESDHTTRSSLRGPRERAPSERSGPAASEHSHRSHHSLTSSLRSHHTHPSYGPPGVPP
LYGPPMLMMTPPPAAMGPPGAPPGRDLASVPPELTASRQSFRMAMGNPSEFFVDVM
NT seq 2151 nt   +upstreamnt  +downstreamnt
atgggcgagaccaagatcatctaccacctggacggccaggagacgccgtacctggtgaag
ctgcccctgcccgccgagcgcgtcaccttggcggactttaagggcgttctgcagcggccc
agctataagttcttcttcaagtctatggacgacgattttggagtggtgaaggaagagatc
tcagacgacaatgccaagctgccctgcttcaatggtcgggtggtgtcctggctggtatct
gctgagggttcccacccagagccagccccattctgtgccgacaacccatcagagctgcca
ccttcaatggagcgcacaggaggcattggggactctcgacccccatcctttcaccctcat
gctagtggaggcagccaagaaaacctggacaatgacacggagactgactccttggtgtct
gcccaacgagagcgtccccgtcggagggatggcccagagcacgcagcccggctcaatgga
actgcgaagggggagcggaggcgagagccaggtggctatgacagttcatctacccttatg
agcagtgagctggagactaccagcttctttgactcagatgaggacgactccaccagcagg
ttcagcagctccacagaacagagcagtgcctcgcgcctaatgaggagacacaagcggcgg
cggcggaagcagaaggtctctcggattgagcggtcttcgtccttcagcagcatcacagac
tccactatgtctctcaatatcatcacagttactctcaacatggaaaagtataacttcttg
ggcatctccattgtgggccaaagcaacgagcgaggtgatggaggcatctacattggctcc
atcatgaagggtggggctgtggcagccgatggacgcattgaaccaggagatatgctgtta
caggtgaatgagatcaactttgagaacatgagtaatgacgatgccgtccgagtacttcgg
gagattgtacacaaaccagggcccatcactctgactgtagccaagtgctgggacccaagt
ccacgtggctgcttcacattaccgcggagtgagcccatccggcccatcgacccagcagcc
tgggtctctcacactgcagccatgacaggcaccttccctgcctatggcatgagcccctcc
ctgagtaccatcacctccactagctcctccatcaccagctccatccctgacacagaacgc
ctagatgacttccacctctccatccacagtgacatggcagccatcgtaaaagccatggcc
tcccctgaatcagggttggaggttcgagaccgcatgtggctcaagattaccattcccaat
gctttcattggctcagatgtggtggactggctgtaccacaacgtggaaggattcacggac
cggcgggaggcccggaagtacgccagcaacctgctgaaagctggtttcatccgccatact
gtcaacaaaatcaccttctctgaacagtgctactatatctttggtgacctctgtggcaac
atggccaacctgtcacttcacgaccatgatggctccagcggcgcctctgaccaggacacc
ctggctcctttgccgcacccaggggctgccccttggcctatggctttcccttaccagtac
ccaccacctccgcatccctacaatccacacccaggcttcccagaactgggctacagctac
ggtgggggtagcgccagcagtcaacacagtgaaggcagtcgaagcagtggctccaacaga
agtggcagcgaccggcgcaaggagaaggacccaaaagctggggactccaaatcaggtggt
agtggcagcgagtcagaccacactacacgcagcagtctgagaggtccacgggagcgggcg
ccaagtgagcgctcaggcccagcagccagcgagcacagtcaccgcagccaccattcgctg
accagcagcctgcgcagccaccacacacacccgagctatggcccgcccggagtgccccct
ctatatggtcccccgatgcttatgatgaccccaccacctgcagccatggggcccccagga
gcccctccaggccgtgacctggcctcggtgcccccggaactgacggccagcagacagtcc
ttccgcatggcaatgggaaaccccagtgagttctttgtggatgtgatgtga

DBGET integrated database retrieval system