KEGG   Cricetulus griseus (Chinese hamster): 100762805
Entry
100762805         CDS       T02813                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: C-terminal-binding protein 2-like
  KO
K04496  C-terminal binding protein
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04310  Wnt signaling pathway
cge04330  Notch signaling pathway
cge05200  Pathways in cancer
cge05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100762805
   04330 Notch signaling pathway
    100762805
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100762805
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100762805
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    100762805
Membrane trafficking [BR:cge04131]
 Endocytosis
  Macropinocytosis
   Others
    100762805
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2
Other DBs
NCBI-GeneID: 100762805
NCBI-ProteinID: XP_035294639
LinkDB
Position
2
AA seq 449 aa
MALVDKHRVKRQRLDRICEGIRPQIMNGPLHPRPLVALLDGRDCTVEMPILKDLATVAFC
DAQSTQEIHEKVLNEAVGAMMYHTITLTREDLEKFKALRVNVRIGSGYDNVDIKAAGELR
IAVCNIPSAAVEETADSTVCHILSLYRRNTWLSQDLREGTWVQSVEQIREVASGAARIRG
ETLGLIGFGRTGQAIAVRAKAFGFSVIFYDPYLQDGIERSLGVQRVYILQDLLYQSNCVS
LYCNRNEHNHHLINDFTIKQMRQGAFLVNAXLVDEKALAQALKEGRIRGAALDVHKSEPF
SFAQGPLKDAPNLICTLHTAWYSEQASLQMREAAAATEIRRAITGRIPESLRNCVNKKEF
FVTSAPWSVIDQQAIHPELNGATYRYPPGIVGMAPGGLPAAMEGIIPGGIPVTHNLPTVA
HPSQAEARRFRSSAILLSGKSWTRRVQEE
NT seq 1350 nt   +upstreamnt  +downstreamnt
atggcccttgtggataagcacagagtcaagcgacagcgattggacagaatttgtgaaggt
atccgccctcagatcatgaacggccccctgcatccccgccccctagtggcactgctcgat
ggcagagactgtaccgtggaaatgcccatcctgaaggatctggccactgtggccttctgt
gatgcacagtccactcaggaaatccatgagaaggtgttgaatgaggctgtgggtgccatg
atgtaccacactatcaccctcaccagggaagacctggagaagttcaaggctcttcgtgtg
aacgtgagaattggcagtggctatgacaacgtggacatcaaggctgctggtgagctcagg
attgctgtttgcaacatcccatctgctgcagtggaggagacagccgattccactgtctgc
cacatcctcagtctgtatcggcggaacacgtggctgtcccaggacctacgagaaggcaca
tgggttcagagcgtggaacagatccgtgaggttgcatcaggagctgctcggatccgaggg
gaaacactgggtctcatcggttttggtcgcacggggcaggcaattgcagttcgagccaag
gcctttggattcagcgtcatattttatgacccctacttacaggatgggatagagcggtct
ctgggcgtgcaaagggtctacatcctgcaagacctgctgtatcagagtaactgtgtctcc
ctgtactgcaatcggaatgagcataaccaccacctcatcaacgacttcactatcaagcaa
atgaggcaaggagcattccttgtgaacgcangtctggtagatgagaaagccctagctcag
gccctcaaagagggaaggatacgaggagcagctctcgatgtgcacaagtctgaacccttc
agctttgctcagggcccattgaaagatgcaccaaatctcatctgcacactgcacacagcc
tggtacagtgaacaagcatcactacagatgagggaagcagcagctgccactgagatccgc
cgagcaatcacaggtcgcatcccagaaagcctgcgaaactgtgtcaacaaaaaagaattc
ttcgttacttcagctccgtggtcagtcatcgaccagcaagcaattcatcccgagctcaac
ggtgccacatacaggtatcccccaggcattgttgggatggctccaggagggcttcctgca
gctatggaagggatcatcccaggaggcatcccggtgactcacaacctccccacagtggca
catccttcccaagctgaagctagacgtttcaggtcctcagctattttattgagtggaaag
tcttggacaagaagggttcaagaagaataa

KEGG   Cricetulus griseus (Chinese hamster): 100766703
Entry
100766703         CDS       T02813                                 

Gene name
Ctbp1
Definition
(RefSeq) C-terminal-binding protein 1 isoform X4
  KO
K04496  C-terminal binding protein
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04310  Wnt signaling pathway
cge04330  Notch signaling pathway
cge05200  Pathways in cancer
cge05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100766703 (Ctbp1)
   04330 Notch signaling pathway
    100766703 (Ctbp1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100766703 (Ctbp1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100766703 (Ctbp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    100766703 (Ctbp1)
Membrane trafficking [BR:cge04131]
 Endocytosis
  Macropinocytosis
   Others
    100766703 (Ctbp1)
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 Cellsynth_D XdhC_C
Other DBs
NCBI-GeneID: 100766703
NCBI-ProteinID: XP_027243022
LinkDB
Position
1
AA seq 441 aa
MGSSHLLNKGLPLGVRPPIMNGPLHPRPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQ
EIHEKVLNEAVGALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNV
PAASVEETADSTLCHILNLYRRTTWLHQALREGTRVQSVEQIREVASGAARIRGETLGII
GLGRVGQAVALRAKAFGFNVLFYDPYLSDGIERALGLQRVSTLQDLLFHSDCVTLHCGLN
EHNHHLINDFTVKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFS
QGPLKDAPNLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVNKDHLTAAT
HWASMDPAVVHPELNGAAYSRYPPGVVSVAPTGIPAAVEGIVPSAMSLSHGLPPVAHPPH
APSPGQTVKPEADRDHTSDQL
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgggcagctcgcacttgctcaacaagggcctgccgctcggcgtccgacctcccatcatg
aacgggcccttgcacccccggcccctggtggcgctgctggatggccgggactgcacagtg
gagatgcctatcctgaaggatgtggccacagtagccttctgtgatgcacagtccacacag
gagatccatgagaaggtactgaatgaggctgtgggtgctctgatgtaccacaccatcaca
ctgaccagagaagatctggagaagttcaaagctctcagaatcatcgtccgaattggcagc
gggtttgacaacattgacatcaagtcagctggggatctaggcatcgcagtatgcaatgtg
cccgcagcatctgtggaagagacggcagactccaccctgtgccacatcctgaacctatac
cgacgaaccacctggctgcatcaggcacttcgggaaggcactcgggtccagagtgtagag
cagatccgagaggtggcttcaggagctgccaggatccgtggagagaccttgggcatcatt
ggactaggtcgtgtgggccaggcagtggcactgcgggcaaaggcttttggcttcaacgtc
ctcttctatgacccatacctatctgatggcatcgagcgggccctggggctgcagcgtgtg
agcacactgcaggacctgctcttccacagtgactgcgtgaccctgcactgcggcctcaat
gagcacaaccaccacctcatcaatgacttcactgtcaagcagatgagacaaggagccttc
ctggtgaacacagcccgtggtggcttggtggacgagaaggcgctggcccaggccctgaag
gaagggcggatccgtggcgcagcgctggacgtgcatgaatcagagcccttcagctttagc
cagggacccttaaaggatgcacccaacctcatctgcacccctcatgccgcatggtacagt
gagcaggcgtccattgagatgcgagaggaggcagcccgagagatccggagagccatcaca
ggccggatcccagatagcttgaaaaactgtgtcaacaaggaccacctgacagctgccacc
cactgggccagcatggaccctgctgtggtgcaccctgagctcaatggggctgcctacagt
aggtaccctccaggtgtggtgagtgtggcccccactggcatcccagctgctgtggaaggt
attgttcccagcgccatgtccctatcccatggcctgccccccgtggcccacccaccccac
gctccttctcctggccagactgtcaagcctgaggcggatagagaccatacaagtgaccag
ttgtag

KEGG   Cricetulus griseus (Chinese hamster): 100769412
Entry
100769412         CDS       T02813                                 

Gene name
Ctbp2
Definition
(RefSeq) C-terminal-binding protein 2 isoform X1
  KO
K04496  C-terminal binding protein
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04310  Wnt signaling pathway
cge04330  Notch signaling pathway
cge05200  Pathways in cancer
cge05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100769412 (Ctbp2)
   04330 Notch signaling pathway
    100769412 (Ctbp2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100769412 (Ctbp2)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100769412 (Ctbp2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    100769412 (Ctbp2)
Membrane trafficking [BR:cge04131]
 Endocytosis
  Macropinocytosis
   Others
    100769412 (Ctbp2)
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2
Other DBs
NCBI-GeneID: 100769412
NCBI-ProteinID: XP_027264935
UniProt: G3HVD1
LinkDB
Position
3
AA seq 445 aa
MALVDKHRVKRQRLDRICEGIRPQIMNGPLHPRPLVALLDGRDCTVEMPILKDLATVAFC
DAQSTQEIHEKVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELG
IAVCNIPSAAVEETADSTVCHILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRG
ETLGLIGFGRTGQAVAVRAKAFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVS
LHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKALAQALKEGRIRGAALDVHES
EPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAITGRIPESLRNCVNKE
FFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLPAAMEGIIPGGIPVTHNLPTV
AHPSQAPSPNQPTKHGDNREHPNEQ
NT seq 1338 nt   +upstreamnt  +downstreamnt
atggcccttgtggataagcacagagtcaagcgacagcgattggacagaatttgtgaaggt
atccgccctcagatcatgaacggccccctgcatccccgccccctagtggcactgctcgac
ggcagagactgtaccgtggaaatgcccatcctgaaggatctggccactgtggccttctgt
gatgcacagtctactcaggaaatccatgaaaaggtgttgaatgaggctgtgggtgccatg
atgtaccacactatcaccctcaccagggaagacctggagaagttcaaggctcttcgtgtg
atcgtgagaattggcagtggctatgacaacgtggacatcaaggctgctggtgagctcggg
attgctgtttgcaacatcccatctgctgcagtggaggagacagccgattccactgtctgc
cacatcctcaatctgtatcggcggaacacatggctgtaccaggccctacgagaaggcaca
cgggttcagagcgtggaacagatccgtgaggttgcatcgggagctgcccggatccgaggg
gaaacactgggcctcatcggttttggtcgcacggggcaggcagttgcagttcgagccaag
gcctttggattcagcgtcatattttatgacccctacttacaggatgggatagagcggtct
ctgggcgtgcaaagggtctacaccctgcaagacctgctgtatcagagtgactgtgtctcc
ctgcactgcaatctgaatgagcataaccaccacctcatcaatgacttcactatcaagcag
atgaggcaaggagcattccttgtgaacgcagccagaggtggtctggtagatgagaaagcc
ctagctcaagccctcaaagagggaaggatacgaggagcagctcttgatgtgcacgagtct
gagcccttcagctttgctcagggcccattgaaagatgcaccaaatctcatctgcacgccg
cacacagcctggtacagtgaacaagcatcactagagatgagggaagcagctgccactgag
atccgccgagcaatcacaggtcgcatcccagaaagcttgcgaaactgtgtcaacaaagaa
ttcttcgttacttcagctccgtggtcagtcatcgaccagcaagcaattcatcccgagctc
aatggtgccacatacaggtatcccccaggcattgttggggtggctccaggagggcttcct
gcagctatggaagggatcatcccaggaggcatcccggtgactcacaacctccccacagtg
gcacatccttcccaagctccctcccccaaccagcccacaaaacacggggacaatcgagag
caccccaacgagcaatag

DBGET integrated database retrieval system