KEGG   Cricetulus griseus (Chinese hamster): 100763110Help
Entry
100763110         CDS       T02813                                 

Gene name
Gck
Definition
(RefSeq) glucokinase
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00010  Glycolysis / Gluconeogenesis
cge00052  Galactose metabolism
cge00500  Starch and sucrose metabolism
cge00520  Amino sugar and nucleotide sugar metabolism
cge00524  Neomycin, kanamycin and gentamicin biosynthesis
cge01100  Metabolic pathways
cge01200  Carbon metabolism
cge04910  Insulin signaling pathway
cge04911  Insulin secretion
cge04917  Prolactin signaling pathway
cge04922  Glucagon signaling pathway
cge04930  Type II diabetes mellitus
cge04950  Maturity onset diabetes of the young
cge05230  Central carbon metabolism in cancer
Module
cge_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cge_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100763110 (Gck)
   00052 Galactose metabolism
    100763110 (Gck)
   00500 Starch and sucrose metabolism
    100763110 (Gck)
   00520 Amino sugar and nucleotide sugar metabolism
    100763110 (Gck)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100763110 (Gck)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100763110 (Gck)
   04910 Insulin signaling pathway
    100763110 (Gck)
   04922 Glucagon signaling pathway
    100763110 (Gck)
   04917 Prolactin signaling pathway
    100763110 (Gck)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    100763110 (Gck)
  09167 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100763110 (Gck)
   04950 Maturity onset diabetes of the young
    100763110 (Gck)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     100763110 (Gck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 100763110
NCBI-ProteinID: XP_007625368
LinkDB All DBs
Position
1
AA seq 505 aa AA seqDB search
MATRRLLQCRPSHPVFINKEALNSPLQLKSGFPSPVIDELSHMPKLQAKENRIIMVEQIL
AEFQLREEDLKKVMRRMQKEMDRGLRLETHEEASVKMLPTYVRSTPEGSEVGDFLSLDLG
GTNFRVMLVKVGEGDAGQWSVKTKQQMYSIPQDAMTGTAEMLFDYISECISDFLDKHQMK
HKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNNIVGLLRDAIKRRGDFEMDVV
AMVNDTVATMISCYYEDRQCEVGMIVGTGCNACYMEEMQNVELVEGDEGRMCVNTEWGAF
GDSGELDEFLLEYDRMVDESSANPGQQLYEKLIGGKYMGELVRLVLLKLVDENLLFHGEA
SEQLRTRGAFETRFVSQVESDSGDRKQIHNILSTLGLRPSVTDCDIVRRACESVSTRAAH
MCSAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPSFKERFHASVRRLTPNCEITFIE
SEEGSGRGAALVSAVACKKACMLGQ
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggctacaaggcggctgctgcaatgccgaccatcacatcctgtgttcataaacaaagag
gcactgaactcccctctccagctaaaatcaggcttcccttcacctgtcattgatgaattg
agtcatatgcccaagctccaagcaaaggagaatagaattattatggtagagcagatcctg
gcagagttccagctgcgggaagaagacctgaagaaggtgatgaggcggatgcagaaggag
atggaccgtggcctgaggctggagacccacgaggaggccagtgtcaagatgttacccacc
tacgtgcgttccaccccagaaggctcagaagttggagactttctctccttggacctggga
ggaaccaacttcagggtgatgctagtgaaggtgggcgagggggatgcaggacagtggagt
gtgaagaccaagcaacagatgtactccatcccccaggatgccatgacgggcactgcagag
atgctctttgactacatctccgagtgcatctctgacttcctggataagcatcagatgaag
cacaagaaactacccctgggcttcaccttctccttccctgtaaggcatgaagacatagac
aagggcatcctcctcaactggaccaagggcttcaaggcctctggggcagaagggaacaac
atcgtgggacttctccgagatgcaatcaagaggagaggggactttgagatggatgtggtg
gcaatggtgaatgacacagtagccacgatgatctcttgctactatgaagaccgccaatgc
gaggtcggcatgattgtgggcactggctgcaatgcctgctacatggaggagatgcagaat
gtggagctggtagaaggggatgagggacgcatgtgtgtcaacactgagtggggcgccttc
ggggactcaggcgagctggatgagttcctgctggagtatgaccggatggtggatgaaagc
tcagcgaaccccggtcagcaactgtacgaaaagctcattggtggaaagtacatgggcgag
ctggtacgacttgtgctgctcaagctggttgatgagaatcttctgttccacggagaagcc
tcggagcagctgcgcacgcgtggcgccttcgagacccgttttgtgtcgcaggtggagagc
gactcgggcgaccgcaagcaaatccacaacatcctgagcactctggggcttcggccctcg
gtcaccgactgcgacatcgtacgccgcgcctgcgaaagcgtgtccacgcgtgccgcccac
atgtgctcagcgggactagccggggtcataaatcgcatgcgcgaaagccgcagtgaggac
gtgatgcgcatcacggtgggcgtggatggctccgtgtacaagttgcaccctagcttcaag
gagcggttccatgccagtgtgcgcaggctgacacccaactgcgaaatcaccttcatcgaa
tcagaggagggcagcggcaggggagcagcgctggtctctgctgtggcctgcaagaaggcc
tgcatgctgggccagtga

DBGET integrated database retrieval system