KEGG   Cricetulus griseus (Chinese hamster): 100763272Help
Entry
100763272         CDS       T02813                                 

Gene name
Camk2g
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit gamma isoform X23
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04012  ErbB signaling pathway
cge04020  Calcium signaling pathway
cge04024  cAMP signaling pathway
cge04066  HIF-1 signaling pathway
cge04114  Oocyte meiosis
cge04217  Necroptosis
cge04261  Adrenergic signaling in cardiomyocytes
cge04310  Wnt signaling pathway
cge04360  Axon guidance
cge04713  Circadian entrainment
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04728  Dopaminergic synapse
cge04740  Olfactory transduction
cge04750  Inflammatory mediator regulation of TRP channels
cge04911  Insulin secretion
cge04912  GnRH signaling pathway
cge04916  Melanogenesis
cge04921  Oxytocin signaling pathway
cge04922  Glucagon signaling pathway
cge04925  Aldosterone synthesis and secretion
cge04934  Cushing syndrome
cge04971  Gastric acid secretion
cge05031  Amphetamine addiction
cge05152  Tuberculosis
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05214  Glioma
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100763272 (Camk2g)
   04310 Wnt signaling pathway
    100763272 (Camk2g)
   04066 HIF-1 signaling pathway
    100763272 (Camk2g)
   04020 Calcium signaling pathway
    100763272 (Camk2g)
   04024 cAMP signaling pathway
    100763272 (Camk2g)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100763272 (Camk2g)
   04217 Necroptosis
    100763272 (Camk2g)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100763272 (Camk2g)
   04922 Glucagon signaling pathway
    100763272 (Camk2g)
   04912 GnRH signaling pathway
    100763272 (Camk2g)
   04921 Oxytocin signaling pathway
    100763272 (Camk2g)
   04916 Melanogenesis
    100763272 (Camk2g)
   04925 Aldosterone synthesis and secretion
    100763272 (Camk2g)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100763272 (Camk2g)
  09154 Digestive system
   04971 Gastric acid secretion
    100763272 (Camk2g)
  09156 Nervous system
   04725 Cholinergic synapse
    100763272 (Camk2g)
   04728 Dopaminergic synapse
    100763272 (Camk2g)
   04720 Long-term potentiation
    100763272 (Camk2g)
   04722 Neurotrophin signaling pathway
    100763272 (Camk2g)
  09157 Sensory system
   04740 Olfactory transduction
    100763272 (Camk2g)
   04750 Inflammatory mediator regulation of TRP channels
    100763272 (Camk2g)
  09158 Development and regeneration
   04360 Axon guidance
    100763272 (Camk2g)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100763272 (Camk2g)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100763272 (Camk2g)
   05205 Proteoglycans in cancer
    100763272 (Camk2g)
  09162 Cancer: specific types
   05214 Glioma
    100763272 (Camk2g)
  09165 Substance dependence
   05031 Amphetamine addiction
    100763272 (Camk2g)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100763272 (Camk2g)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100763272 (Camk2g)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cge01001]
    100763272 (Camk2g)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100763272 (Camk2g)
Protein kinases [BR:cge01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   100763272 (Camk2g)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr SnoaL_3 DUF4440 Pkinase_fungal Kdo SnoaL_2 RIO1
Motif
Other DBs
NCBI-GeneID: 100763272
NCBI-ProteinID: XP_027243322
LinkDB All DBs
Position
1
AA seq 619 aa AA seqDB search
MATTATCTRFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQI
LESVNHIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKL
KGAILTTMLVSRNFSVGRQSSAPASPAASAAGLAGQAAKSLLNKKSDGGVKSYSCHLRPS
TSRPDQGTREVWESNLSNVGDSGGTKPSVFLSQPQSNNKNSLVSAAQEPAPLQTAMEPQT
TVVHNATDGIKGSTESCNTTTEDEDLKAAPLRTGNGSLVPEGRSPRDRTAPSAGMQPQPS
LCSSAMRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYF
ENLLSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRD
GRWLNVHYHCSGAPAAPLQ
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaccgccacctgcacccgcttcaccgacgactaccagcttttcgaggagctc
ggcaagggtgccttctcagtggtccgaaggtgtgtgaagaaaacatctacgcaggaatat
gcagcaaaaatcatcaataccaagaagttgtcagcccgagatcatcagaaactagagcga
gaggcccggatatgccgacttctgaaacatccaaacattgtgcgtctccatgacagtatt
tctgaagaagggtttcactacctcgtgtttgaccttgttactggaggggagttgtttgaa
gacattgtggccagagaatactacagtgaagctgatgccagccactgtatacatcagatt
ctggagagtgttaaccacatccaccagcatgacattgtccaccgggacctaaagcctgaa
aacttgctgctggcgagtaaatgcaagggtgctgcggtcaagctagctgattttggcctc
gccatcgaagtgcagggagagcagcaggcttggtttggttttgctggcaccccaggttat
ttgtcccctgaggtcttgaggaaagatccctatggaaaacctgtggatatctgggcctgc
ggggtcatcctgtatatcctcctggtgggctaccctcccttctgggatgaggatcagcac
aagctatatcagcagatcaaagctggagcctacgatttcccatcaccagaatgggacacg
gtgactcctgaagctaagaacttgatcaaccagatgttgaccataaacccagcaaagcgt
atcacagctgaccaggctctcaagcatccatgggtctgtcaacgatccacagtagcatcc
atgatgcatcgccaagagacagtggagtgcttgcgcaaattcaatgccaggagaaaactg
aagggtgccatcctcacgaccatgctcgtctccaggaacttttcagttggcaggcagagc
tccgcccccgcctcgcctgccgcgagcgccgccggcctggccgggcaagctgccaaaagc
ctattgaacaagaagtcagatggcggtgtcaagtcttacagttgccacctcaggcctagc
acctctcggccagaccaggggacaagggaggtctgggagtcaaatctgagcaacgttggt
gactctggaggaactaaaccatctgttttcttgtctcagccacagagcaacaacaaaaac
agtctcgtaagcgcagcccaagagcccgcgcccttgcagacggccatggaaccacaaacc
accgtggtacacaatgctacagatgggatcaagggctccacagagagctgtaacaccact
acagaagatgaagacctcaaagctgccccgctccgcactgggaatggcagcttggtgccc
gaaggacggagcccccgggacagaacagccccctctgcaggcatgcagccccagccttct
ctctgctcctcagccatgcgaaaacaggagatcattaagatcacagaacaactgatcgaa
gccatcaacaatggggactttgaggcctacacgaagatttgtgacccgggcctcacttcc
tttgagccagaagcccttggtaacctcgtggaggggatggatttccataagttttacttt
gagaatctcctgtctaagaacagcaagcccatccataccaccatcctaaacccgcacgtc
cacgtgattggggaggacgcagcttgcatcgcctatatccggctcacccagtacatcgat
gggcagggtcggcctcgcaccagccagtcagaggagacccgggtgtggcaccgccgggat
ggcaggtggctcaatgtccactatcactgctcaggggcccctgccgcaccgctgcagtga

DBGET integrated database retrieval system