KEGG   Cricetulus griseus (Chinese hamster): 100763542
Entry
100763542         CDS       T02813                                 

Gene name
Rela
Definition
(RefSeq) transcription factor p65 isoform X4
  KO
K04735  transcription factor p65
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01523  Antifolate resistance
cge04010  MAPK signaling pathway
cge04014  Ras signaling pathway
cge04024  cAMP signaling pathway
cge04062  Chemokine signaling pathway
cge04064  NF-kappa B signaling pathway
cge04066  HIF-1 signaling pathway
cge04071  Sphingolipid signaling pathway
cge04137  Mitophagy - animal
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04218  Cellular senescence
cge04380  Osteoclast differentiation
cge04620  Toll-like receptor signaling pathway
cge04621  NOD-like receptor signaling pathway
cge04622  RIG-I-like receptor signaling pathway
cge04623  Cytosolic DNA-sensing pathway
cge04625  C-type lectin receptor signaling pathway
cge04657  IL-17 signaling pathway
cge04658  Th1 and Th2 cell differentiation
cge04659  Th17 cell differentiation
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04668  TNF signaling pathway
cge04722  Neurotrophin signaling pathway
cge04917  Prolactin signaling pathway
cge04920  Adipocytokine signaling pathway
cge04926  Relaxin signaling pathway
cge04931  Insulin resistance
cge04932  Non-alcoholic fatty liver disease
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05030  Cocaine addiction
cge05132  Salmonella infection
cge05133  Pertussis
cge05134  Legionellosis
cge05135  Yersinia infection
cge05140  Leishmaniasis
cge05142  Chagas disease
cge05145  Toxoplasmosis
cge05146  Amoebiasis
cge05152  Tuberculosis
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05162  Measles
cge05163  Human cytomegalovirus infection
cge05164  Influenza A
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05202  Transcriptional misregulation in cancer
cge05203  Viral carcinogenesis
cge05212  Pancreatic cancer
cge05215  Prostate cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05222  Small cell lung cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cge05321  Inflammatory bowel disease
cge05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100763542 (Rela)
   04014 Ras signaling pathway
    100763542 (Rela)
   04064 NF-kappa B signaling pathway
    100763542 (Rela)
   04668 TNF signaling pathway
    100763542 (Rela)
   04066 HIF-1 signaling pathway
    100763542 (Rela)
   04071 Sphingolipid signaling pathway
    100763542 (Rela)
   04024 cAMP signaling pathway
    100763542 (Rela)
   04151 PI3K-Akt signaling pathway
    100763542 (Rela)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100763542 (Rela)
  09143 Cell growth and death
   04210 Apoptosis
    100763542 (Rela)
   04218 Cellular senescence
    100763542 (Rela)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100763542 (Rela)
   04621 NOD-like receptor signaling pathway
    100763542 (Rela)
   04622 RIG-I-like receptor signaling pathway
    100763542 (Rela)
   04623 Cytosolic DNA-sensing pathway
    100763542 (Rela)
   04625 C-type lectin receptor signaling pathway
    100763542 (Rela)
   04660 T cell receptor signaling pathway
    100763542 (Rela)
   04658 Th1 and Th2 cell differentiation
    100763542 (Rela)
   04659 Th17 cell differentiation
    100763542 (Rela)
   04657 IL-17 signaling pathway
    100763542 (Rela)
   04662 B cell receptor signaling pathway
    100763542 (Rela)
   04062 Chemokine signaling pathway
    100763542 (Rela)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100763542 (Rela)
   04917 Prolactin signaling pathway
    100763542 (Rela)
   04926 Relaxin signaling pathway
    100763542 (Rela)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100763542 (Rela)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100763542 (Rela)
  09149 Aging
   04211 Longevity regulating pathway
    100763542 (Rela)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100763542 (Rela)
   05202 Transcriptional misregulation in cancer
    100763542 (Rela)
   05203 Viral carcinogenesis
    100763542 (Rela)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100763542 (Rela)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100763542 (Rela)
   05221 Acute myeloid leukemia
    100763542 (Rela)
   05220 Chronic myeloid leukemia
    100763542 (Rela)
   05215 Prostate cancer
    100763542 (Rela)
   05222 Small cell lung cancer
    100763542 (Rela)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100763542 (Rela)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100763542 (Rela)
   05022 Pathways of neurodegeneration - multiple diseases
    100763542 (Rela)
  09165 Substance dependence
   05030 Cocaine addiction
    100763542 (Rela)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100763542 (Rela)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100763542 (Rela)
   04931 Insulin resistance
    100763542 (Rela)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100763542 (Rela)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100763542 (Rela)
   05135 Yersinia infection
    100763542 (Rela)
   05133 Pertussis
    100763542 (Rela)
   05134 Legionellosis
    100763542 (Rela)
   05152 Tuberculosis
    100763542 (Rela)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100763542 (Rela)
   05170 Human immunodeficiency virus 1 infection
    100763542 (Rela)
   05162 Measles
    100763542 (Rela)
   05164 Influenza A
    100763542 (Rela)
   05161 Hepatitis B
    100763542 (Rela)
   05160 Hepatitis C
    100763542 (Rela)
   05168 Herpes simplex virus 1 infection
    100763542 (Rela)
   05163 Human cytomegalovirus infection
    100763542 (Rela)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100763542 (Rela)
   05169 Epstein-Barr virus infection
    100763542 (Rela)
   05165 Human papillomavirus infection
    100763542 (Rela)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100763542 (Rela)
   05145 Toxoplasmosis
    100763542 (Rela)
   05140 Leishmaniasis
    100763542 (Rela)
   05142 Chagas disease
    100763542 (Rela)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100763542 (Rela)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cge03000]
    100763542 (Rela)
Transcription factors [BR:cge03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    100763542 (Rela)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 100763542
NCBI-ProteinID: XP_027264385
LinkDB
Position
3
AA seq 552 aa
MDDLFPIIFPSEPTQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKSTLYFGQINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSF
QNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPL
RLTPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGW
EARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTD
DRHRIEEKRKRTYETFKSIMKKSPFNGPTEPRPPARRIAVPSRSSTVSKPAPQPYTFPTS
LSTINFDEFPPMVLPSGQISNQALASAPVLAQTLVPSSAMVPALAQPPAPVSVLAPGPPQ
ALAPPVPKTTQAGEGTLSEALLHLQFDADEDLGALLGNSTDPGVFSDLASVDNSEFQQLL
NQGVSMTHPTAEPMLMEYPEAITRLVTGSQRPPDPVPTPLGTSGLPNGLSGDEDFSSIAD
MDFSALLSQISS
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggacgatctatttcccatcatcttcccctcagagccaacccaggcttctgggccttat
gtggagatcatcgagcagcccaaacaacggggcatgcgtttccgctacaagtgtgagggt
cgctcagcaggcagtattccgggtgagagaagcacagataccaccaagacacaccccacc
atcaagagtactctgtactttggacagatcaatggctacacgggaccaggaacagttcga
atctccctggtcaccaaggacccacctcaccggcctcatccacatgaacttgtggggaaa
gactgccgggatggtttctatgaggctgaactctgcccagaccgctgcatccacagcttt
cagaacctggggatccagtgtgtgaagaagcgagacctggagcaagccatcagccagcgc
atccagaccaacaacaacccctttcaagttcctatagaggagcagcgtggggactatgac
ctgaatgcagtgcgcctctgcttccaggtgacggtgcgggacccatcaggcaggcccctc
cgcctgactcctgtcctctctcatcctatttttgataaccgtgcacccaacactgctgag
ctcaagatctgccgagtaaaccggaactccgggagctgccttggtggggatgagatcttc
ttgctgtgtgacaaagtgcagaaagaagacatcgaggtgtatttcactggaccaggctgg
gaagcacgaggctccttttctcaagctgatgtgcaccggcaagtggctattgtgttccgg
actcctccatacgctgaccccagcctgcaggctcctgtgcgtgtctccatgcagcttcgg
cggccttctgatcgggagctcagtgagcccatggagttccagtacctgccagacacagat
gatcgccaccggattgaagagaaacgcaaaaggacctacgagaccttcaagagcatcatg
aagaaaagtccttttaatggacctactgaaccccggcctccagcacgacgtattgctgtg
ccttctcgaagctcaactgtctccaagccagccccccagccctatacctttccaacatcc
ctcagcaccatcaactttgatgagtttccccccatggtgttaccatctgggcagatctca
aaccaggccttggcctcggcaccagtcctggcccaaaccttggtcccctcctctgccatg
gtgccagctctggctcagcccccagcccctgtctcagttctagccccaggtcctccccaa
gccctggccccacctgttccaaagaccacccaggccggggaaggcacactgtctgaagcc
ctgctacacctgcagtttgatgctgatgaagacttgggggccttgcttggcaacagcaca
gacccaggtgtgttctcagacctggcatctgtcgacaactcagagtttcagcaactcctg
aaccagggtgtgtccatgactcaccccacagctgagcccatgctcatggagtacccagaa
gctataactcggctagtgacagggtcccagaggccccctgacccagttcccacacccctg
gggacctcgggccttcccaatggcctctcaggggatgaagacttctcctccattgcggac
atggacttctcagctcttctgagtcagatcagctcctaa

DBGET integrated database retrieval system