KEGG   Cricetulus griseus (Chinese hamster): 100763555Help
Entry
100763555         CDS       T02813                                 

Gene name
C8g
Definition
(RefSeq) complement component C8 gamma chain
  KO
K03999  complement component 8 subunit gamma
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04610  Complement and coagulation cascades
cge05020  Prion diseases
cge05146  Amoebiasis
cge05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:cge00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100763555 (C8g)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100763555 (C8g)
  09164 Neurodegenerative disease
   05020 Prion diseases
    100763555 (C8g)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100763555 (C8g)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin
Motif
Other DBs
NCBI-GeneID: 100763555
NCBI-ProteinID: XP_027278691
LinkDB All DBs
Position
6
AA seq 200 aa AA seqDB search
MLSPRAVLFFTLLLTTSSLTQRTRKPSGSTSPISTIQAQANFNAQQFAGTWRLVAVGSPC
RFLQEQGHRAEATTLHAAPQGAAMAVSTFRKLDGICWQVRHLFGDTGVPGRFLLQGARVP
VRVVVAETDYQNFAILYLEKARKLSVKLYVRSLPVSDSALDVFEQRVREANLTEHQIFFF
PKYGFCETADQFHILNEVPR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcccctagggctgtgttgttcttcaccctgctcttgacaaccagttcgctgacc
caaaggacccgaaagccctctgggtctacatcccccatcagcaccatccaggcccaggcc
aatttcaatgctcagcagtttgcagggacgtggcgccttgtggctgtgggctctccatgc
cgctttcttcaggagcagggccaccgggctgaggccaccacgttgcacgcagctcctcag
ggtgcagcgatggctgtcagcaccttccgaaagctagatgggatctgttggcaggtgcgc
catctctttggagatacaggggtccctggtcgcttcttgctccaaggggcccgtgtgcca
gtgcgtgtggttgttgctgagactgactaccagaactttgccatcctgtatctggagaag
gcaaggaagctgtctgtgaaactatatgtccgttcattgcccgtgagtgattctgccctg
gatgtgtttgagcagcgagtcagggaagccaacctgacagaacaccagatctttttcttt
cccaaatatggtttctgcgagactgcggaccagttccacatcctgaatgaggtcccaaga
tga

DBGET integrated database retrieval system