KEGG   Cricetulus griseus (Chinese hamster): 100763961
Entry
100763961         CDS       T02813                                 

Gene name
Nr3c1
Definition
(RefSeq) glucocorticoid receptor isoform X2
  KO
K05771  glucocorticoid receptor
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100763961 (Nr3c1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cge03000]
    100763961 (Nr3c1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:cge03310]
    100763961 (Nr3c1)
Transcription factors [BR:cge03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    100763961 (Nr3c1)
Nuclear receptors [BR:cge03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   100763961 (Nr3c1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4 SCA7
Other DBs
NCBI-GeneID: 100763961
NCBI-ProteinID: XP_027253807
LinkDB
Position
2
AA seq 774 aa
MDSKESLAPSGREVPSSFVRERGNLMDFHKSLRGGATVKLSASSSSLAAASQKDSKQQRL
LLDFPKGSTSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGYPQQGQISLSSGETDFRL
LEESIENLNRSTSVPENPKSSASATGHAAPTEKEFPKTHSDASSEQQNLKSQTGTNGGNV
KLYTADQSTFDILQDLEFSAGSPGKETNVSPWRSDLLIDENLLSPLAGDDDPFLLEGDAN
EDCKPFVLPDTKPKIKDTGDPILPSPSSVTLPQVKTEKDDFIELCTPGVIKQEKLGPVYC
QSGFSGTNIMANKISAISVHGVSTSGGQMYHYDMNSASLSEEQDQKPVFNVIPPIPVGSE
NWNRCQGSGEDNLASLGTMNFPGRSVFSNGYSSPGMRPDVSSPPSSSSTATGPPPKLCLV
CSDEASGCHYGVLTCGSCKVFFKRAVEGRQHNYLCAGRNDCIIDKIRRKNCPACRYRKCL
QAGMNLEARKTKKKIKGIQQATTGVSQDTSENPNKTIVPAALPQLTPTLVSLLEVIEPEV
LYSGYDSSIPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFL
MAFALGWRSYKQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMMYVSSELKRLQVSYEEY
LCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLD
SMHDVVENLLSYCFQTFLDKSMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK
NT seq 2325 nt   +upstreamnt  +downstreamnt
atggactccaaagaatccttagccccttctggtagagaagtccctagcagttttgtccgt
gagagggggaacttgatggactttcataaaagcctgaggggaggagctaccgtgaagctt
tctgcatcttcgtcctcactggctgctgcttctcagaaggattccaagcagcagaggctt
ctccttgattttccaaaaggctcaactagcaatgcgcagcagccagatttgtccaaagcc
gtgtcactgtccatgggactgtatatgggagagacagaaacaaaagtgatgggaaatgac
ttgggatacccacagcagggccaaattagcctttcctctggggagacagactttcggctt
ctggaagaaagtattgaaaacctcaataggtcaaccagtgttccagagaatcccaagagt
tcagcatctgctactgggcatgctgcccctacagagaaggagtttcccaaaactcattct
gatgcatcttcagaacagcaaaatcttaaaagccagactggcaccaacggtggcaatgtg
aaattgtatacagcagaccaaagcacctttgacatcttgcaggatttggagttttctgct
gggtccccaggtaaagagacaaatgtgagtccctggaggtcagacctgttgatagatgag
aacttgctttctcctttggcaggagatgatgatccattccttttggaaggagatgcaaat
gaggactgtaagccttttgttttaccggacactaaacctaaaattaaggatactggagat
ccgatcttaccaagccccagcagtgtgacgctgccccaggtgaaaacagaaaaagatgat
ttcattgaactttgcacccctggggtaattaagcaagagaaactgggcccagtttattgt
cagtcaggcttttctgggacaaatataatggctaataaaatatctgccatttctgttcat
ggcgtgagtacctctggaggacagatgtaccactatgacatgaactcagcatccctttct
gaggagcaggatcagaagcctgtttttaatgtcattccaccaattcctgttggttctgaa
aactggaataggtgccaaggatctggagaggataacctggcttccctggggacaatgaac
ttcccaggccgatcggtgttttctaatggctattccagccctggaatgagaccagatgta
agctctcctccgtctagctcctcaacagcaacaggaccacctcccaaactctgcctggtg
tgctctgatgaagcttcaggatgtcattatggggtattaacatgtgggagctgtaaagta
ttcttcaaaagagcagtggaaggtagacagcacaattatctttgtgctggaagaaatgat
tgcatcattgataaaattcgaagaaaaaactgcccagcatgccgctatcgaaaatgtctt
caagctggaatgaaccttgaagcccgaaaaacaaagaaaaaaataaaagggattcagcaa
gccactacaggagtctcacaagacacttctgaaaatcctaacaaaacgatagttcctgca
gcattaccacaacttacccctaccctggtatcactgctggaggtgattgaacctgaggtc
ttatattcaggatatgacagctctattccagactcaacttggagaatcatgaccacactc
aacatgttaggtgggcgccaagtgattgcagccgtgaaatgggcaaaggcaataccagga
ttcagaaacttacacctggatgaccaaatgaccctcctgcagtactcatggatgtttctc
atggcatttgccctgggttggagatcatacaaacaatcaagtgcaaacctgctgtgtttt
gctcctgatctgattattaatgagcagagaatgactctaccctgcatgtatgaccaatgt
aaacacatgatgtatgtctcctccgagttaaaaagattgcaggtatcctatgaagagtat
ctctgtatgaaaaccttactgcttctctcctcagttcctaaggaaggtctgaagagccaa
gagttatttgatgagattcgaatgacctatatcaaagaactaggaaaagccattgtcaaa
agggaaggaaactccagtcagaactggcagcggttttatcaactgacaaaactgttggac
tccatgcatgatgtggttgaaaacctcctttcctattgcttccaaacatttttggataag
agcatgagtattgaattcccagagatgttagctgaaatcatcactaatcagataccaaaa
tattcaaatggaaatatcaaaaagcttctgtttcatcaaaaatga

DBGET integrated database retrieval system