KEGG   Cricetulus griseus (Chinese hamster): 100764056Help
Entry
100764056         CDS       T02813                                 

Gene name
Tmprss2
Definition
(RefSeq) transmembrane protease, serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge05164  Influenza A
cge05202  Transcriptional misregulation in cancer
cge05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    100764056 (Tmprss2)
  09162 Cancers: Specific types
   05215 Prostate cancer
    100764056 (Tmprss2)
  09172 Infectious diseases: Viral
   05164 Influenza A
    100764056 (Tmprss2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cge01002]
    100764056 (Tmprss2)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     100764056 (Tmprss2)
Peptidases [BR:cge01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100764056 (Tmprss2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 DUF1986 Hepsin-SRCR Ldl_recept_a SRCR Trypsin_2
Motif
Other DBs
NCBI-GeneID: 100764056
NCBI-ProteinID: XP_007629322
LinkDB All DBs
Position
Un
AA seq 557 aa AA seqDB search
MALNSGSPPGIGPYYENHGFQSEHIYHTPRPPVGPDGYNLYPDQYYPSPVPQYAPRVTTQ
ASTTAIHTQPNSSGTLCTSTSKTKKSLCFALALVTVLAGAAVAAVLLWKFLPGCSTSEME
CMSSGTCISSSLWCDGIAHCPNGEDENRCVRLYGPSFTLQVYSSQREAWYPVCQDDWNDS
YGRAACKDMGYKNNFYYTQGIPDSSGATSFMKLNTSAGNIDLYKKLYHSDSCTSRMVVSL
RCIECGIRSVRRQSRIVGGSNASPGDWPWQVSLHVQGVHVCGGSIITPEWIVTAAHCVEE
PLNSPRYWTAFAGILKQSLMFYGNRHQVEKVISHPNYDSKTKNNDIALMKLQTPLTFNEL
VKPVCLPNPGMMLDPAQECWISGWGSTYEKGKTSEVLNAAMVPLIERYKCNNKYIYNSLI
TPAMICAGFLQGTVDSCQGDSGGPLVTLKNDIWWLIGDTSWGSGCAKAFRPGVYGNVTVF
TDWIYQQMRVGTDKPDYAEGHEEKAREMGRMEGADQQVYLSLKATQCGLEEGEQLIHVAF
VPGFFCLRYPSTRKPRG
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggctttgaactcagggtcacctccaggaatcggaccttactatgagaaccatgggttt
cagtccgagcacatctatcataccccaaggccacctgtgggtcccgatggctacaacttg
tatccagaccagtactacccatctccagtgccccagtatgccccgagggttacaacacag
gcctcaacaactgccatccacacacagcccaattcctcagggacactgtgcacctcaacc
tcaaagaccaagaaatcgctgtgtttcgcccttgccctggtcactgtccttgcaggtgct
gctgtggctgctgtcttgctttggaagttcttgccagggtgctctacatctgagatggag
tgcatgtcttcaggcacctgcatcagctcgtctctctggtgtgatgggatagcacactgc
cccaacggggaagatgagaaccggtgtgttcgcctctatggaccaagcttcaccctccaa
gtttactcatctcagagggaagcctggtatcctgtgtgccaggatgattggaatgacagc
tacgggagagcagcatgcaaagacatgggctacaagaacaatttttattatacccaagga
ataccagatagcagcggggcaacgagctttatgaagctaaacacaagcgcaggcaacatc
gacctctataagaaactctaccacagtgactcctgtacgtcccgcatggtggtttcttta
cgctgtattgaatgtgggatccgctcagtgagacgccagagcaggattgtgggtggatca
aatgcttcaccaggagactggccctggcaggtcagcctgcacgttcaaggtgtccatgtc
tgtggaggctccatcatcacccccgagtggattgtgacagccgctcactgtgtggaagaa
cccctcaacagcccgaggtactggacagcgttcgcggggattttgaaacagtctctcatg
ttctatggaaatagacaccaggtagaaaaagtgatttcccatccaaattacgactctaag
accaagaataatgacatcgctctcatgaagctgcagacgcctctgacttttaatgagcta
gtgaagccagtgtgtctgccgaacccaggcatgatgctggacccggcacaagaatgctgg
atttcagggtgggggtccacctatgagaaagggaagacctcggaagtgctgaatgctgcc
atggtacccttgatcgagcgctacaaatgtaacaataaatacatatacaacagccttatc
acaccagccatgatctgtgccggcttcctgcagggcaccgtggattcttgtcagggagac
agtggaggtcctttggttactttgaagaatgacatctggtggctgattggggacacaagc
tggggctctggctgtgccaaggcattcagacctggagtgtatgggaacgtgacagtattt
acagactggatctaccagcaaatgagggtgggaacagacaagcccgactatgctgagggc
catgaagagaaggctagagagatgggcagaatggagggagctgaccagcaggtgtattta
agcctgaaggccactcagtgtggccttgaggaaggcgaacagctaatccacgtggccttt
gtccctggcttcttttgtcttcgatacccttccacaagaaaaccaaggggctga

DBGET integrated database retrieval system