KEGG   Cricetulus griseus (Chinese hamster): 100764257
Entry
100764257         CDS       T02813                                 

Gene name
Fgf1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04010  MAPK signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04390  Hippo signaling pathway
cge04810  Regulation of actin cytoskeleton
cge05200  Pathways in cancer
cge05218  Melanoma
cge05224  Breast cancer
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100764257 (Fgf1)
   04014 Ras signaling pathway
    100764257 (Fgf1)
   04015 Rap1 signaling pathway
    100764257 (Fgf1)
   04390 Hippo signaling pathway
    100764257 (Fgf1)
   04151 PI3K-Akt signaling pathway
    100764257 (Fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100764257 (Fgf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100764257 (Fgf1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100764257 (Fgf1)
   05218 Melanoma
    100764257 (Fgf1)
   05224 Breast cancer
    100764257 (Fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cge04052]
    100764257 (Fgf1)
   00536 Glycosaminoglycan binding proteins [BR:cge00536]
    100764257 (Fgf1)
Cytokines and growth factors [BR:cge04052]
 Growth factors
  Growth factors (RTK binding)
   100764257 (Fgf1)
Glycosaminoglycan binding proteins [BR:cge00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   100764257 (Fgf1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 100764257
NCBI-ProteinID: XP_035294941
LinkDB
Position
2
AA seq 155 aa
MAEGEITTFSALTERFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESAGEVYIKGTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggagaaatcaccaccttctcagccctgacagagagatttaatctgcctcca
ggaaactacaagaagcccaaactgctctactgcagcaacgggggccacttcttgaggatc
cttccagatggcacagtggatgggacaagggacaggagtgaccagcacattcagctgcag
ctgagtgcggaaagcgcgggcgaagtgtatataaagggtacagagacaggccagtacttg
gccatggacacggatggccttttatacggctcacagacaccaaatgaagaatgcctgttc
ctggaaaggctggaagaaaaccattacaacacttatacatccaagaagcacgcagagaag
aactggtttgtgggcctcaagaaaaacgggagctgcaagcgtggtcctcggactcactat
ggccagaaagcaatcttgtttctccccctgcctgtatcttctgactag

DBGET integrated database retrieval system