KEGG   Cricetulus griseus (Chinese hamster): 100764455Help
Entry
100764455         CDS       T02813                                 

Gene name
Gstz1
Definition
(RefSeq) glutathione S-transferase zeta 1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00350  Tyrosine metabolism
cge01100  Metabolic pathways
Module
cge_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    100764455 (Gstz1)
Enzymes [BR:cge01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     100764455 (Gstz1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2 GST_C_5 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 100764455
NCBI-ProteinID: XP_007624745
LinkDB All DBs
Position
Un
AA seq 216 aa AA seqDB search
MQAGKPVLYSYFRSSCSWRVRIALALKGIDYEIVPINLIKDGGQQFSEEFQTLNPMKQVP
ILKIDGITIGQSLAIMEYLEETRPTPRLLPQDPKKKAIVRMISDLIASGIQPIQNLSVLK
QVGQENQMPWAQRAITSGFNALEQILQSTAGKYCVGDEVSMADVCLVPQVANAERFKVDL
SPYPTISHINKALLALEAFQVSHPCRQPDTPAELRA
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccgggaagcctgtcctctattcctatttccgaagctcctgttcatggagagtt
cgaatagctctggcactgaaaggcattgactatgaaatagtgcccatcaacctcataaag
gatggggggcaacagttctcagaggaatttcagaccctgaatcccatgaaacaagtgcca
atcctgaagatcgacggaatcaccattggccagtcactggccatcatggagtacctggaa
gaaactcggcccaccccacgtctcctgcctcaggacccaaagaaaaaagccattgtgcgc
atgatttctgacctcatcgctagtggcatccagcccattcagaacctgtctgtcctgaag
caagtgggacaggagaaccagatgccttgggcacagagggctatcacttctggctttaat
gctctggagcagattctgcagagcacagcagggaagtactgtgtaggagatgaggtgtcc
atggctgatgtgtgcttagtgccccaagtggcaaatgctgaaaggttcaaggtggacctc
agcccctaccctaccatcagtcacatcaacaaagccctgctggccctagaggctttccaa
gtgtctcacccctgtcgacagccagatacacctgctgagctgagggcatag

DBGET integrated database retrieval system