KEGG   Cricetulus griseus (Chinese hamster): 100764557Help
Entry
100764557         CDS       T02813                                 

Gene name
Hdac2
Definition
(RefSeq) histone deacetylase 2
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04110  Cell cycle
cge04213  Longevity regulating pathway - multiple species
cge04330  Notch signaling pathway
cge04919  Thyroid hormone signaling pathway
cge05016  Huntington disease
cge05034  Alcoholism
cge05165  Human papillomavirus infection
cge05169  Epstein-Barr virus infection
cge05200  Pathways in cancer
cge05202  Transcriptional misregulation in cancer
cge05203  Viral carcinogenesis
cge05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100764557 (Hdac2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100764557 (Hdac2)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100764557 (Hdac2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100764557 (Hdac2)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    100764557 (Hdac2)
   05202 Transcriptional misregulation in cancers
    100764557 (Hdac2)
   05203 Viral carcinogenesis
    100764557 (Hdac2)
   05220 Chronic myeloid leukemia
    100764557 (Hdac2)
  09163 Neurodegenerative diseases
   05016 Huntington disease
    100764557 (Hdac2)
  09164 Substance dependence
   05034 Alcoholism
    100764557 (Hdac2)
  09167 Infectious diseases
   05169 Epstein-Barr virus infection
    100764557 (Hdac2)
   05165 Human papillomavirus infection
    100764557 (Hdac2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cge03036]
    100764557 (Hdac2)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100764557 (Hdac2)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     100764557 (Hdac2)
   HDAC complexes
    Sin3A-HDAC complex
     100764557 (Hdac2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100764557 (Hdac2)
  Chromatin remodeling factors
   NuRD complex
    100764557 (Hdac2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 100764557
NCBI-ProteinID: XP_007637029
LinkDB All DBs
Position
Un
AA seq 488 aa AA seqDB search
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEESGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDSSGEKTDSKGA
KSEQLSNP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacagtcaaggaggcggcaagaagaaagtgtgctactactatgacggtgatatt
ggaaattattattatggccagggtcatcccatgaagcctcatagaatccggatgactcat
aacttgctgctaaattatggtttataccgaaaaatggaaatatataggcctcataaagcc
actgctgaagaaatgacaaaataccacagtgatgagtatatcaaatttctacgatcgata
agaccagataacatgtctgagtatagtaagcagatgcagagatttaacgttggagaagat
tgtccagtatttgatggactctttgagttttgtcagctctccactggtggttcagttgct
ggggctgtgaagttaaaccggcaacaaactgatatggctgtcaactgggccggaggatta
catcatgccaaaaagtcagaagcatcaggattctgctatgttaatgatattgtacttgcc
atccttgagttactaaagtaccatcagagagtcttgtatatcgacatagacatccatcat
ggtgatggtgttgaggaagctttttatacaacagatcgtgtgatgacagtttcattccat
aagtatggggaatactttcctggaacaggagatttgagggatattggtgctggaaaagga
aagtactatgctgtcaactttcccatgagagatggtatagatgatgagtcctatggacaa
atttttaagcctataatctcaaaagtgatggagatgtaccagcctagtgctgtggtgctg
cagtgtggtgcagactcactgtctggtgataggcttggctgcttcaatctcactgtcaaa
ggtcatgctaaatgtgtagaagtagtaaaaactttcaacttgccattgctgatgcttggt
ggaggtggctatacaatccgaaacgttgctcggtgttggacatatgagactgcagttgcc
ctggattgtgaaattcctaatgagttgccatataatgattactttgagtattttggaccg
gatttcaaactgcatattagtccttcaaacatgacaaaccagaacactccagaatatatg
gaaaagataaaacagcgtttatttgaaaatcttcgaatgttgccacatgcacctggcgtt
caaatgcaagcgattccagaagatgctgttcatgaagagagcggggatgaggatggagaa
gatccggacaagcggatttcgattcgtgcatcagacaagcggatagcttgtgatgaagaa
ttctcagattctgaggatgaaggcgaaggaggtcgtcggaatgttgctgatcataagaaa
ggagcaaagaaagctaggattgaagaggacaagaaggagacagaggacaaaaagacagat
gttaaggaagaagacaaatccaaggacagtagtggtgaaaaaacagattccaaaggagcc
aaatcagaacaactcagcaacccttga

DBGET integrated database retrieval system