KEGG   Cricetulus griseus (Chinese hamster): 100764772Help
Entry
100764772         CDS       T02813                                 

Gene name
Stat2
Definition
(RefSeq) signal transducer and activator of transcription 2 isoform X1
  KO
K11221  signal transducer and activator of transcription 2
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04062  Chemokine signaling pathway
cge04217  Necroptosis
cge04380  Osteoclast differentiation
cge04621  NOD-like receptor signaling pathway
cge04625  C-type lectin receptor signaling pathway
cge04630  Jak-STAT signaling pathway
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05162  Measles
cge05164  Influenza A
cge05165  Human papillomavirus infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100764772 (Stat2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100764772 (Stat2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100764772 (Stat2)
   04625 C-type lectin receptor signaling pathway
    100764772 (Stat2)
   04062 Chemokine signaling pathway
    100764772 (Stat2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100764772 (Stat2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100764772 (Stat2)
  09172 Infectious disease: viral
   05162 Measles
    100764772 (Stat2)
   05164 Influenza A
    100764772 (Stat2)
   05161 Hepatitis B
    100764772 (Stat2)
   05160 Hepatitis C
    100764772 (Stat2)
   05168 Herpes simplex virus 1 infection
    100764772 (Stat2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100764772 (Stat2)
   05169 Epstein-Barr virus infection
    100764772 (Stat2)
   05165 Human papillomavirus infection
    100764772 (Stat2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cge03000]
    100764772 (Stat2)
Transcription factors [BR:cge03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100764772 (Stat2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT_alpha STAT2_C STAT_int STAT_bind SH2
Motif
Other DBs
NCBI-GeneID: 100764772
NCBI-ProteinID: XP_027248515
LinkDB All DBs
Position
1
AA seq 842 aa AA seqDB search
MAQWETLQNLDSPFLDQLHQLYSQSILPMDVRQHLAAWIEDQNWREASLGNDQSKANMLY
FNILDQLNQWDHSSDPDCFLLQHNLRKFSRDIQTFSNGPTQLAGMIFNLLLEEKRILNQA
QRAQEVQARPAPEVAVGSQQLETESRILDLQARVEMLVRSIRQLKDLHDVFSFRYTVFTQ
KKTSSLDPHQKEQFQLVQTTANELDRMRKEVLDTSRTLVGRLTTLVDLLLPKLDEWKVQQ
QKSCIGAPLPELQLEQLEQWLTAGAKLLFHLRQLLRQLKEMSHMLKYDGDMFSKGVDLQN
AQVTELLQRLLQRSFVVETQPCMPQTLHRPLILKTGSKFTVRTRLLVRLQEGNESLKAEV
SIDRNSELPGFRKFNILTSNQKTLTPEEGQRQGLVWDFGFLTLVEQRSVGTGKGTNKGPL
AVMEELHVISFVVQYVYQGLKMELQTDTLPVVIISNMNQLSIAWASVLWFNMLSPTPQNP
KFFCHAPKAPWSLLGPVLSWQFSSYVGRGLNSEQLGMLKNKLFGKNCRMEDALLSWVDFS
KRDSPPGKIPFWTWLDKILELVHDHLKELWNDGHIMGFVSRNQERRLLKKMVSGTFLLRF
SETSEGGITCSWVEHQDDDKVIIYSVQPYTKEVLQSLPLTEIIRHYQVLADENIPENPLR
FLYPRIPRDEAFGCYYQEKVNFEERRKYLKHRLIVVSNRQVDELQQPPELKPEAELDPLE
LNEDLMSAMTLEQDLDLQTLLEEGLDLGTKLELNPTPCVDPQTMPEADPGPASQLSPESD
LPQDLQQLNMVDMEIFRNNIINIDDIMPHGDPLLADQNIGDEAYMSCQSHFDVDGPLIPS
DD
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaatgggagacactgcagaatcttgacagcccgtttctggaccagctgcaccag
ctatactctcaaagcatcctgccaatggatgttagacagcacttggctgcctggattgaa
gaccagaactggcgggaggcctcgctaggcaatgatcagtccaaggccaacatgctgtac
ttcaacatcctggaccagctgaaccagtgggaccactcctcagaccctgattgcttttta
ttgcagcataacttgcgaaaattcagccgggacatccagaccttttctaatggccctacc
cagctggctgggatgatctttaaccttctcctggaagagaaaagaattctgaatcaggct
caaagggctcaggaggtacaagccaggccagctcctgaagtggcagtgggaagccagcag
cttgagactgaatcccgaatcctggatttacaggctagggttgagatgttggtgagatcc
atcaggcaactgaaagacctgcacgacgtcttcagcttcagatacacggttttcactcaa
aagaagacatcatctttggaccctcatcagaaggaacagttccagcttgtacagacaaca
gccaatgaactggacagaatgagaaaggaagtgctggatacgtccagaacactagtaggc
cgattaaccaccctggttgacctgttgctgccaaaattggatgagtggaaggtgcagcag
cagaaatcttgcattggagccccactgccagagctgcagctggaacagctggaacagtgg
ttgacggctggagcaaagctcctgttccaccttcgacagctgctgagacagctgaaggaa
atgagccacatgcttaagtatgacggggacatgttcagcaaaggggtggacctgcaaaat
gcccaagtcacagagttactacaacgcctgctccaaaggtcctttgtggtagaaacccag
ccctgcatgccccaaacccttcatcgacccctcatcctgaagactgggagcaagttcact
gtccgaacaagactgctggtgagactccaggagggcaacgagtcactcaaagcagaggtc
tccattgacaggaattcagagttaccaggcttccggaaattcaacattctgacctcaaac
caaaaaaccttgacccctgaggagggccagagacaaggtttagtttgggactttggcttc
ttgacgctggtggagcaacgttctgtggggacaggaaagggcaccaataaggggccgctg
gccgtaatggaggagttacatgtcatcagctttgtggtgcaatacgtgtaccaaggtctg
aagatggagctgcagacggacacgctccctgtggtgatcatttctaacatgaaccagctc
tccattgcctgggcctcagttctctggttcaacatgctcagcccaaccccccagaacccc
aaattcttctgccatgctcctaaagccccctggagcttgctggggcctgttctcagttgg
caattctcctcgtatgttggccgaggcctcaattctgagcagctgggcatgctgaagaac
aagctctttggaaagaactgcaggatggaggatgcattgttgtcctgggtggacttcagt
aagagagacagcccccctggcaagatccctttctggacgtggctggacaaaattctggag
ctggtccatgaccacctgaaggagctctggaatgatgggcacatcatgggctttgtgagc
cggaaccaggaacgccgactgctgaagaagatggtctctgggacctttcttctgcgcttc
agtgaaacttctgaggggggcatcacttgctcttgggtggagcaccaggatgatgataaa
gtgatcatctactccgtgcagccctacaccaaggaagtgctacagtcactcccactgaca
gaaataatccgccactaccaggttcttgccgacgagaacatccctgagaaccctttacgc
ttcctctatcccagaatccctcgggatgaagcttttgggtgctactaccaggaaaaagtt
aattttgaagagcggaggaaatacctgaaacacaggctaattgtggtctccaacagacag
gtggacgagctgcagcaacctccagaacttaaaccggaagcagaactggatccgttagag
ctaaatgaagatctcatgtcagccatgacattagaacaagacctggatttacagacgctg
ctggaggaagggctggatctagggacaaagctggaactaaaccccacaccgtgtgtggac
ccacaaacaatgccagaggcagacccaggacctgcctcgcagctgtcaccagagtcagat
ttacctcaagatctgcagcagctgaacatggtggatatggaaattttcagaaacaacatc
ataaatattgatgacatcatgccccacggtgacccgctgttggctgatcagaacatcgga
gacgaagcctacatgtcctgccagagccattttgatgtggatggacccttgattccttct
gatgactag

DBGET integrated database retrieval system