KEGG   Cricetulus griseus (Chinese hamster): 100764983
Entry
100764983         CDS       T02813                                 

Definition
(RefSeq) tumor suppressor ARF isoform X2
  KO
K06621  cyclin-dependent kinase inhibitor 2A
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01522  Endocrine resistance
cge01524  Platinum drug resistance
cge04110  Cell cycle
cge04115  p53 signaling pathway
cge04218  Cellular senescence
cge04934  Cushing syndrome
cge05163  Human cytomegalovirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05206  MicroRNAs in cancer
cge05212  Pancreatic cancer
cge05214  Glioma
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05223  Non-small cell lung cancer
cge05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:cge00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100764983
   04115 p53 signaling pathway
    100764983
   04218 Cellular senescence
    100764983
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100764983
   05206 MicroRNAs in cancer
    100764983
   05203 Viral carcinogenesis
    100764983
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100764983
   05225 Hepatocellular carcinoma
    100764983
   05214 Glioma
    100764983
   05220 Chronic myeloid leukemia
    100764983
   05218 Melanoma
    100764983
   05219 Bladder cancer
    100764983
   05223 Non-small cell lung cancer
    100764983
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100764983
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100764983
   05163 Human cytomegalovirus infection
    100764983
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100764983
   01522 Endocrine resistance
    100764983
SSDB
Motif
Pfam: P19Arf_N
Other DBs
NCBI-GeneID: 100764983
NCBI-ProteinID: XP_027256201
UniProt: A0A3L7I770
LinkDB
Position
2
AA seq 146 aa
MGRGRRFSPPVSHGGDRWASAAAGSMGYRFLVTVRIRRRRADRPPRVRAFVVQFPRSSRH
RSASRARAVVALLLMLARSQRGPRLHPGAGHDDGQHPSSQTAAALRCRTELRGPSHPLPT
RARCSAGGLLGNSEDTAPGGGAAGCA
NT seq 441 nt   +upstreamnt  +downstreamnt
atgggccgggggcggcgcttctcacctcccgtgtcacacggaggcgaccgctgggcgagt
gcagcggctgggagcatggggtacaggttcctggtgactgtgcggattcggcggcggcgc
gcagatcgcccacctcgagtgagggctttcgtggttcagttcccgcgatcttcgcgacac
cggtcagcgagccgcgcacgggccgtagtggccctgctgttgatgctagcgaggagccag
cgagggccgcggctgcatcctggagcaggtcatgatgatgggcaacacccaagtagccag
actgctgctgctctacggtgccgaaccgaactgcgaggacccagccaccctctcccgacc
cgtgcacgatgcagcgcgggagggcttcttggaaactctgaagatactgcaccaggcggg
ggcgcggctggatgtgcatga

DBGET integrated database retrieval system