KEGG   Cricetulus griseus (Chinese hamster): 100765011Help
Entry
100765011         CDS       T02813                                 

Gene name
Lig3
Definition
(RefSeq) DNA ligase 3
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge03410  Base excision repair
Module
cge_M00296  BER complex
Brite
KEGG Orthology (KO) [BR:cge00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    100765011 (Lig3)
Enzymes [BR:cge01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100765011 (Lig3)
DNA repair and recombination proteins [BR:cge03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     100765011 (Lig3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N zf-PARP DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme HD_2
Motif
Other DBs
NCBI-GeneID: 100765011
NCBI-ProteinID: XP_003495846
LinkDB All DBs
Position
7
AA seq 955 aa AA seqDB search
MTLAFKILFPRNLCALGRKELCLFSEQNHWPVIRQFSQWSETDLLRGCCLLQRRKPVLSF
QGGHLRPRATHLVFFPGSHVGLYTGPYEMAEQRFCVDYAKRGTAGCKKCKEKILKGVCRI
GKVVPNPFSESAGDMKEWYHVKCIFEKLERARATTKKIEDLTELEGWEELEDDEKEQISQ
HIADLSSKAAGTPKKKTAVQAKVTTTGQVSSPVKGASFVTSTNPRKFSGFSAAKTNNSEQ
GSLSSAPKTSLSTSKCDPKHKDCLLREFRKLCAMVAENPSYNTKTQIIQDFLQKGSAGDG
FHGDVYLTVKLLLPGVVKSVYNLNDKQIVKLFSRIFKCNPDDMARDLEQGDVSETIRVFF
EQSKSFPPAAKSLLTIQEVDAFLLHLSKLTKEDEQQQALQDIASRCTANDLKCIIRLIKH
DLKMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLHNEQEVKYQGQRRTLSVQASLMT
PVQPMLAEACKSIEYAMKKYPNGMFSEIKYDGERVQVHKKGDHFSYFSRSLKPVLPHKVA
HFKDYIPKAFPGGQSMILDSEVLLIDNNTGKPLPFGTLGVHKKAAFQDANVCLFVFDCIY
FNDVSLMDRPLCERRKLLHDNMVEIQNRIMFSEMKQVTKASDLADMINRVIREGLEGLVL
KDVKGTYEPGKRHWLKVKKDYLNEGAMADTADLVVLGAFYGQGSKGGMMSIFLMGCYDPD
SQKWCTVTKCAGGHDDATLARLQKELDMVKISKDPSKIPSWLKINKIYYPDFIVSDPKKA
AVWEITGAEFSKSEAHTADGISIRFPRCTRIRDDKDWKSATNLPQLKELYQLSKEKADFD
VVAGDEGNSSTGGSNGENEGTAGSAAPHKAPKAPPSKSSASDKKAKQKLNNPNSRDGNKV
IPKPSPMKPGDKLAMKSSPVKVGVKRKAADETQCPTKRRRARQQRGRRAVPTGRR
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atgactttggctttcaagatcctcttcccgagaaacctttgtgcccttggcagaaaagaa
ctgtgcctgttctcagaacagaatcactggcctgtcataagacagttcagccagtggtcg
gaaacagatctccttcgtgggtgctgcctcctccagagaagaaagcctgtcctatctttc
cagggaggtcatctaagaccacgtgccacccaccttgttttcttcccagggtcgcatgtg
ggactctatactggcccctatgagatggcggagcagcggttctgtgtggactatgccaag
aggggcacagctggttgcaagaaatgcaaggagaagattttaaagggcgtatgccgcatt
ggcaaagtggtgcccaatcccttctcagagtctgcgggcgatatgaaagagtggtaccat
gttaagtgcatatttgagaaactggagcgggctcgggctaccacaaaaaaaattgaagac
ctcacagagctagaaggctgggaagagctggaagatgacgaaaaggaacagatcagccag
cacattgcagacctgtcctctaaggcagctgggacacctaagaagaaaaccgctgtccag
gctaaggtgacaaccactggccaggtgtcatccccagtgaaaggtgcttcgtttgtcacc
agtaccaatcctcggaaattttctggattttcagcagccaaaaccaacaactctgagcaa
ggctccttaagctctgcccctaagacaagtctgtctacaagtaaatgtgaccctaagcac
aaagactgtctactacgagagttccggaagctgtgcgccatggtggctgaaaatcctagc
tacaatacaaagacccagatcatccaggacttcttgcagaaaggctctgcaggagatggc
ttccacggtgatgtgtacctaacagtgaagctactgctgccgggagtcgttaagagtgtt
tacaacttgaacgataagcagattgtgaaactttttagccgaatttttaagtgcaaccca
gatgatatggcccgggacctagaacagggtgacgtatcagagacgatcagagtcttcttt
gagcagagcaagtctttccccccagctgccaagagcctcctcaccatccaggaagtggat
gccttcctcctgcacctctccaagctcaccaaagaggatgagcagcagcaggccctgcag
gacattgcctccaggtgtacagccaatgaccttaagtgcatcatccggctgatcaagcat
gatctgaagatgaactcgggtgcaaagcatgtgttagatgcccttgaccccaatgcttat
gaagccttcaaagcctcgcgaaacctgcaggatgtggtggagcgagtccttcacaatgag
caggaggtgaagtaccaaggccagcgacggactctgagcgttcaggcctcactgatgact
cctgtgcagcccatgctggctgaggcctgcaagtccatcgagtatgcaatgaagaagtat
cccaatggcatgttctctgagatcaagtacgatggtgagcgagtccaggtgcataagaag
ggggaccacttcagctacttcagccgcagtctcaagcctgtcctgcctcacaaggtggcc
cactttaaggactacatccccaaagcctttcctgggggtcagagcatgatcttggactcc
gaagtgctcctgattgacaacaacactggcaaaccactgccctttgggactctgggagtg
cacaagaaagctgccttccaggatgctaatgtttgcctgtttgtttttgattgtatctac
tttaatgatgtcagcttgatggacaggcctctctgtgagagaaggaagcttcttcacgac
aacatggttgaaatccagaaccggatcatgttctcagaaatgaagcaagtcacaaaagcc
tccgacctggctgacatgataaaccgggtgatccgagagggcttagaagggctggtgcta
aaggatgtaaagggtacatacgagcctgggaagcgacactggctgaaagttaagaaagat
tatttgaacgagggggccatggcagatacagctgatctggtggttcttggggccttctat
gggcaagggagcaaaggtggtatgatgtccatcttcctcatgggctgctatgaccctgac
agccagaagtggtgcactgtcaccaaatgtgctggaggccacgatgatgccacacttgcc
cgactgcagaaggagctagatatggtgaagatcagcaaggatcccagcaagatacctagc
tggctgaagatcaacaagatctactatcctgacttcattgtttcagacccaaagaaagct
gctgtgtgggagatcacaggggcagaattttccaaatctgaggctcacactgctgatggg
atctccatccgatttcctcgatgcactcgaatccgggacgacaaggactggaaatctgcc
actaacctcccccaactcaaggaactataccagctgtccaaagaaaaggcagacttcgat
gtagtggctggagatgaggggaattccagtaccggaggtagcaatggtgagaatgagggc
actgctgggtctgctgcaccccacaaggcccccaaggcacctcctagtaagtcctctgcc
agtgacaagaaggccaaacagaagctgaataaccccaacagcagagatggcaacaaggtg
attccaaagccttcccccatgaaaccaggagacaagctggctatgaagtcttctccagtg
aaagtaggggtgaagaggaaagctgctgatgaaacccagtgcccgacaaagaggcggcgg
gccagacagcaaagaggaaggagagctgtgccaacaggcaggagatag

DBGET integrated database retrieval system