KEGG   Cricetulus griseus (Chinese hamster): 100765413Help
Entry
100765413         CDS       T02813                                 

Gene name
Hk1
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00010  Glycolysis / Gluconeogenesis
cge00051  Fructose and mannose metabolism
cge00052  Galactose metabolism
cge00500  Starch and sucrose metabolism
cge00520  Amino sugar and nucleotide sugar metabolism
cge00524  Neomycin, kanamycin and gentamicin biosynthesis
cge01100  Metabolic pathways
cge01200  Carbon metabolism
cge04066  HIF-1 signaling pathway
cge04910  Insulin signaling pathway
cge04930  Type II diabetes mellitus
cge04973  Carbohydrate digestion and absorption
cge05230  Central carbon metabolism in cancer
Module
cge_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cge_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100765413 (Hk1)
   00051 Fructose and mannose metabolism
    100765413 (Hk1)
   00052 Galactose metabolism
    100765413 (Hk1)
   00500 Starch and sucrose metabolism
    100765413 (Hk1)
   00520 Amino sugar and nucleotide sugar metabolism
    100765413 (Hk1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100765413 (Hk1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100765413 (Hk1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100765413 (Hk1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100765413 (Hk1)
 09160 Human Diseases
  09161 Cancers
   05230 Central carbon metabolism in cancer
    100765413 (Hk1)
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100765413 (Hk1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    100765413 (Hk1)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100765413 (Hk1)
Membrane trafficking [BR:cge04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100765413 (Hk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 VPS13_mid_rpt
Motif
Other DBs
NCBI-GeneID: 100765413
NCBI-ProteinID: XP_003499940
UniProt: G3H6T5
LinkDB All DBs
Position
Un
AA seq 917 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDEILIDILTRFKKEMKNGLSRDYNPTAS
VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEAYETPENIVH
GSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCRQTKIDEAILITWTKRFKASGV
EGTDVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDRELDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGIQHAKEILTRLG
VEPSDDDCVSVQHVCTIVPFRSANLVAATLGAILNRLRDNKGTARLRTTVGVDGSLYKTH
PQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAALVTAVAYRLAEQHRQIEETLANFRLS
KQTLMEVKQRMRTEMEMGLKKETHNNATVKMLPSYVRGIPDGSENGDFLALDLGGTNFRV
LLVKIRSGKKRTVEMHNKIYSIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGF
TFSFPCNQTSLDCGILITWTKGFKATDCVGHDVVTLLKDAIKRREEFDLDVVALVNDTVG
TMMTCAYEEPTCEVGLIVGTGSNACYMEEMRNVEMVEGNQGQMCINMEWGAFGDNGCLDD
IRTDFDKVVDEYSLNAGKQRFEKMISGMYLGEIVRNILIDFTKKGFLFRGQISEPLKTRG
IFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSKRAAQLCGAGMAA
VVEKIRENRGLDHLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCTVSFLLSEDGSGKG
AALITAVGVRLRGDTTS
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatcgctgcgcagctcctagcctattacttcaccgagctgaaggatgaccaagtcaaa
aagattgataagtatctgtatgccatgcggctctctgatgaaattctgatagatatcctg
acgcgattcaagaaagagatgaagaatggcctttcccgggattataatccaacagcctcg
gtcaagatgctaccgacctttgtgaggtccatccctgacggctcagaaaagggggatttc
atcgccctggatcttggcggctcttccttccgaatcctgagggtgcaggtgaatcatgag
aagaatcagaatgtccacatggagtctgaggcctacgaaaccccggagaacatcgtgcac
ggcagtggaagccagcttttcgatcatgttgctgagtgcctgggggacttcatggagaaa
agaaagatcaaggacaagaaattacctgtgggattcacgttttctttcccctgccgacaa
accaaaatagacgaggctatcctgatcacatggacaaagcggttcaaagccagcggtgtg
gaagggacagatgtggtcaagctgctgaataaagccattaagaagcgaggggactacgac
gccaacattgtagctgtagtgaatgacacagtcgggaccatgatgacctgcggctatgat
gaccaacagtgtgaagttggcctgatcattggtactggcaccaatgcttgctacatggag
gagctgcgtcacattgacctggtggaaggcgatgaagggaggatgtgcattaacacggaa
tggggagcctttggggacgacgggtccctggaagatatccggactgagttcgacagagag
ttagaccgggggtccctcaaccctgggaagcagttgttcgagaagatggtgagcgggatg
tacatgggggagctggtccggctgatcctggtgaagatggccaaggaaggcctcttgttt
gaggggcgcatcactccagagctgctcacgaggggcaagttcaacactagtgacgtgtca
gccattgaaaagaataaggaaggcattcaacatgccaaggaaatcttaacccgcctggga
gtggagccatctgacgatgactgtgtttcggtccagcatgtatgcaccattgtccccttt
cgctcagccaacctagtggctgccacactcggggccatcttgaaccgccttcgtgacaac
aagggcacagccaggcttcggaccacagttggtgtagatggttctctctacaagacccac
ccacagtattcccggcgtttccacaagaccctgaggcgcctggtgcctgactccgatgtg
cgtttcctcctctcagagagtggcagtggcaagggggctgccttggtaaccgcagtggcc
taccgcctggccgagcagcaccggcagatagaggaaaccctggccaacttccgcctctcc
aagcagaccctgatggaggtgaagcaaaggatgcggactgagatggaaatgggactgaag
aaggagacacacaacaatgctaccgtcaagatgctgccttcctatgtccgaggcatccca
gatgggtctgagaatggtgacttcttggccttggatcttggaggaaccaatttccgtgtc
ctgctggtaaagatccgcagtgggaagaagagaacagtggaaatgcataacaagatctac
tccatccctatagagatcatgcagggcaccggggaagagctgtttgaccacattgtctcc
tgcatctccgacttcctggactacatggggatcaaaggcccccggatgcctctgggcttc
accttctcatttccctgcaatcagacgagcctggattgtggaatcttgatcacctggaca
aagggtttcaaggccactgactgtgtgggtcatgacgtagtcactttactgaaggatgcg
ataaaaaggagagaggaatttgacttggatgtggtggctttggtcaacgacactgtaggc
accatgatgacctgtgcatatgaggaacccacttgtgaagttggactcatcgtagggact
ggcagcaatgcctgctacatggaggagatgcggaatgtagagatggtggaggggaaccag
ggccagatgtgtatcaacatggagtggggcgcctttggcgacaacgggtgtttggatgac
atcagaacagacttcgacaaagtggtggacgagtactcactaaacgccgggaaacaaagg
tttgaaaagatgatcagtggaatgtacctgggtgagatcgtccgtaacatcctgatcgac
ttcaccaagaaagggttcctcttccggggacagatctctgagccactcaagactcggggc
atctttgagaccaagtttctctctcagattgagagtgaccgattagcactgctccaggtt
cgggccatccttcagcagctgggtctgaacagcacgtgtgacgacagtatcctggtcaag
actgtgtgcggggtggtatccaagagggccgctcagctgtgtggtgctggcatggctgcc
gtggtagagaagattagagagaacagaggactagaccatctgaacgtgactgtgggagtg
gatgggacgctctacaaacttcatccacacttctctagaatcatgcatcaaactgtgaag
gagctgtcaccaaagtgcactgtgtccttcctcctgtctgaagatggcagtggcaagggg
gctgccctgatcacagctgtgggcgtgcggctcagaggagatacgacctcctaa

DBGET integrated database retrieval system