KEGG   Cricetulus griseus (Chinese hamster): 100765637Help
Entry
100765637         CDS       T02813                                 

Gene name
Setd2
Definition
(RefSeq) SET domain containing 2
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100765637 (Setd2)
Enzymes [BR:cge01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100765637 (Setd2)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100765637 (Setd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW
Motif
Other DBs
NCBI-GeneID: 100765637
NCBI-ProteinID: XP_007632919
LinkDB All DBs
Position
Un
AA seq 2514 aa AA seqDB search
MFSWLNGNREEENEAKIENVQKTGFIKGPVFKGVASSRFLPKGTKTKVNLEEQGRQKVSF
SFSLTKKTLQNRFLTALSNEKQSDSPNSPATPLQVDSSPKAKMDTGDTFPTTEESSPPKS
RVELGRIHFKKHLLHVTSRPQLATATSPPPTIQLPAVIAESTVDSPPSSPPPPPPPPQAT
SPSPPASTSEPVALPHPPVTVPMTAPVPLPVDSAQKEPPIKIVPESLEVGMKQDIVSNSL
EEHTIQTLREQADNPLQREDSHIGKEEEVSDGSKTSLSSKKASSKKKSSQFEGTFLGSES
DEDSVRTSSSQRSHDLKSSTSIEKERDFKKSSAPSKSEDLGKSSRSKTERDDKYFSYSKL
ERDTRYVSSRCRSERDRRRSRSRSRSDRVSRTSLSYSRSERSHYYDSDRRYHRSSPYRER
TRYSRPYTDNRARESSDSEDEYKKTYPRRTSSHSYRDLRTSSSYSKFDRDCKTETSYLEM
ERRGKYSSKLERESKRTSDHEAIKRCCSPPTELGFRRGSSYSKHDNSASRYKSALSKPVS
KSDKFKNSFCCTELNEENKQSHFSLQTPCSKGSELRTSNKIPEREKTGAPSPSNQLNDSP
TFKKLDESPILKREFTEHDSHDSIKELESLSKVKNDQLRSFCSIELNINGSPETESDTVT
FCASKTDAFSLTSDDSVTGSEVSPLIKACMLSSNGFQNIGRCKEDDSDDTYRQHNKSQSP
FRETEPLLLPHHDKLVSLPVKTIDYPKTLIKDPVDKRRSCCKTKDSDRYCSPNENSEAEN
PETSVVKISSNSFMNVHLESEIVLCDNTELTDQHSKCACDEYKQSIGSTGSASLNHFDDV
YESVGSSGIVSSLPSGVRCEENTSPVLDAVQSKKSTEFLKYAGKETEVGSALPDSAKGFA
SWENRYNNVLSGQSLQEAQEEGNSILHDRRGRTEISLDEEEGRSRTHTSDDSEVVFSYDL
NLTMEDSDSITYTLKCDSSGNIPEISTVHEDYSASSGSSSEESGSEDTESDDSSVPRHRL
QSVVVVPKNSTLPMEETSPCSSRSSHSYRHYSDHWEDERLESRRHSYEDKFENMTSKGCP
QTEKFFLHKGTERNPETYSQFSRKVDNHLPEIAHSQSDGVDSTSHTDLKSDSLGHLNSED
TVRAKTSRSQELPVYSSDDFEDIPNKSRQQMIFSNRPDSSRLGKTEVNFSSCDISHMDGL
HSSEELRNLGWDFSQQERPTTTYQQPDSSYGACGTHKYQQSAEHFAGTHSYWQGNGYWDP
RSAGRPTGTGVAYDRIQGQVPDSLTDDREEESWDQRSGSHFPSQSSKFLFHQKDKGSVQA
PEISSNSVKDTLVPNERKEFSKNFEKNDIKERGPPKKRRQEVESDSESDGELQARKKMRV
ESEPGETSVLLQSELMGPSCAMEDFRDPQRWKEFAKLGKMPCYFDLIEENVYLTERKKNK
SHRDIKRMQCECTPLSKDERAQGEVACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQH
ADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMAL
KNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQ
RYGKEAQKCFCGSANCRGYLGGENRVSIRAAGGKMKKERSRKKDSVDGELEALMENGEGL
SDKNQVLSLSRLMVRIETLEQKLTCLKLIQNTHSQSCLKSFLERHGLSLLWIWMAELGDG
RESNQKLQEEIIKTLEHLPIPTKNMLEESKVLPIIQRWSQTKTAVPPLSEGDGYSSENTS
RAHTPLNTPDPSIKLSTEVDTETPKKLVFRRLKIISENSMDSAISDVTSELECKDGKEDL
DQLETVTVEEDDDLQSQQLLPQQPCESKVESETTIEVSKLPTSEPEADTEAELKESSGTK
LEETIAEETPSQDEEEGVSDVESERSQEPPDKTVDISDLATKLLDSWKDLKEVYRIPKKS
QTEKESTVTERGRDAAAFRDQTVPKTPNRSRERDPDKPTQNKEKRKRRGSLSPPSSAYER
GTKRPDDRYDTPTSKKKVRIKDRNKLSTEERRKLFEQEVAQREAQKQQQQMQNLGMTSPL
PFDSLGYNASHHPFAGYPPGYPMQAYVDPSNPNAGKVLLPTPSMDPVCSPAPYDHAQPLV
GHSTESLAAPASVPVVPHVAASVEVSSSQYVAQNESVVHQDSSVPVMPVQAPGPVQGQNY
SVWDSNQQSVSVQQQYSPAQSQATIYYQGQTCSTVYGVTSPYSQTTPPIVQSYAQPNLQY
IQGQQIFTAHPQGVVVQPTSAVTTIVAPGQPQSLQPPEMVVTNNLLDLPPPSPPKPKTIV
LPPNWKTARDPEGKIYYYHVITRQTQWDPPTWESPGDDANLEHEAEMDLGTPTYDENPMK
TSKKPKTAEADTSSELAKKSKEVFRKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLAR
KLTHGVMNKELKYCKNPEDLECNENVKHKTKEYIKKYMQKFGAVYKPKEDTELE
NT seq 7545 nt NT seq  +upstreamnt  +downstreamnt
atgttttcttggctgaatgggaatagagaagaagaaaatgaggcaaagattgaaaatgtg
cagaaaacaggtttcatcaaaggaccagtgttcaaaggtgttgcttctagtcgatttttg
cccaaaggcacgaagacaaaagttaatttggaggaacagggacggcagaaggtgtcattc
agcttcagtcttacaaagaaaactttacagaataggtttctcactgcacttagcaatgaa
aagcagagtgattctccaaattcaccagctacacctcttcaagtagactcaagccctaaa
gctaaaatggacacaggagatacttttcctactacagaagaatcttccccaccaaagtca
agagtagaattgggtagaattcattttaagaaacatctccttcacgtgacatccaggcca
cagctggctacagccacatctccccctcctacaatacagttaccagcagtcatagcagaa
tcaaccgtggactcaccaccttcatctccccctccccctcctccccctcctcaagccaca
tcaccctcaccaccagcatcaacatcagagccagtggccttgccacatcccccagtaaca
gtaccaatgactgcaccagtacccttaccagtggatagtgctcagaaagaaccaccaatt
aaaattgtaccagaatctttagaggtgggtatgaagcaggatattgtatctaatagtttg
gaagaacacacaattcagactttgagggaacaagcagataatcccctgcaaagagaagat
tcccatattgggaaggaagaagaagtttcagatggttctaagacaagcctcagttctaaa
aaagcaagttctaagaagaaatcgtcacaatttgaaggcacatttcttggttcagaatct
gatgaagattctgtacggacttcctccagtcaaagatcacatgatttaaaatcttcaaca
agcattgagaaggaaagagattttaaaaagagctcagcaccttcaaaaagtgaggatttg
gggaaatcatcgagatctaaaacagagagagatgataaatacttcagctactcaaaactt
gaaagagatactcggtatgtatcttcccgatgtaggtcggaaagagaccgaaggcggagc
cgatcgcggtctagatctgacagagtctctagaaccagtttgtcttattctcggtcagag
cgatctcattattatgattctgatcggcgctaccataggagttccccttaccgtgagagg
acacgctattctcggccatatacggataacagggcacgggagagctccgactctgaggat
gaatataagaagacatatccaaggcgcacctcatcccattcctacagagacctaaggaca
tcatcatcttactctaaatttgatcgggactgtaaaactgagacctcttacttagagatg
gagagaagaggaaagtattcttcaaaactagaaagagaatccaagcggacttcagaccat
gaagccataaaaagatgttgttctcccccaactgaactgggattccgacgggggtcctcc
tattccaagcatgacaacagtgcttcccgttacaaatctgccctttcaaaacctgtatcc
aagtctgataaatttaagaattctttctgttgtacagaattaaatgaggaaaacaaacaa
tctcattttagtttgcagactccttgttcaaaaggtagtgaattaagaacaagtaataaa
attcctgaaagagaaaagactggggctccatctccatcaaatcaattaaatgattcacct
acttttaaaaagctagatgaatctcctattcttaagcgtgaatttacagaacatgatagc
catgatagtattaaggaattggagtcattatcaaaagtgaaaaatgatcagttaagaagt
ttttgttccattgagttaaatataaatggatctccagagacggaatctgatacggtaaca
ttttgtgcttctaaaacagatgctttttcattgacttctgatgatagtgtgactggatca
gaggtgtcccctttgatcaaggcttgcatgctttcatcaaatggatttcagaatattggt
aggtgcaaagaagacgactcggatgatacctataggcagcataataagtcacaaagcccg
tttagggagacagaacccttgttgttaccacaccatgataaactcgtgtctttgccagtt
aagactatagattatcccaaaacattaattaaagatccagttgataagagacgttcttgc
tgcaaaaccaaagattcagatagatattgttctccaaatgagaactctgaagctgaaaat
cctgaaacttcagttgtgaagatttcttcaaatagctttatgaatgtgcatttggaatca
gaaatagttctatgtgataatacagagctgacagatcagcactcaaaatgtgcatgtgat
gaatataagcagagcatcggtagcactggttcagcttcacttaaccattttgatgatgtg
tatgagtctgtagggagttcaggtattgtttcatctcttccgtcaggagtaaggtgtgaa
gagaatacatctccagttctagatgcagtgcagagtaaaaaaagcacagagtttttaaag
tatgcagggaaagaaacagaagtgggtagtgcccttcctgattcagcaaaggggtttgct
tcttgggaaaacaggtataataatgtattatctgggcagtctttgcaagaggctcaagaa
gaagggaattccatattgcatgatagaagaggaagaacagaaatctccttagatgaggaa
gaagggcgatcgcgtacacacacttctgatgactcagaggttgtattttcttatgatttg
aacttaaccatggaggacagtgacagtataacttacaccttaaaatgtgacagtagcggt
aatattcctgaaatatctactgtccatgaggattattctgcatcttctggaagttcaagc
gaggaaagtggttcagaagatacagagtctgatgatagcagtgttccaagacaccgtctc
cagtctgttgtggttgtgccaaagaattctactttgcccatggaagagacgagtccctgt
tcttctcggagcagtcatagctaccgacattattctgaccattgggaagatgaacgatta
gagtcaaggagacattcatatgaggataagtttgagaatatgacaagtaaaggctgtcct
cagactgaaaaattcttccttcacaaaggaacggagaggaatccagaaacttattcacag
ttcagcagaaaagtagataatcacctgcctgaaattgctcattctcaaagtgatggggtt
gatagtacaagtcacacagacttgaaatctgactctttaggtcacctgaattcagaggac
acagtaagagccaaaacatctaggtcacaagagctaccagtttattcttctgatgatttt
gaagatatcccaaataagtctcggcagcagatgattttctctaacaggccagatagtagt
agactagggaaaacagaggtgaacttttcttcttgtgacatttcccatatggatggcttg
cactcatcagaagagctcagaaacctggggtgggatttctcccaacaagaaagacccact
accacatatcagcaacctgacagcagctatggagcctgtggcacacacaagtatcaacaa
agtgctgaacattttgctggaacccatagttactggcaaggcaatggctattgggatcca
agatcagcaggcagacctacaggaactggggtggcttatgaccgaattcaagggcaggta
ccagattcgctaacagatgatcgtgaagaggagagttgggatcaacgaagtggatcacat
tttccaagccagtccagtaagttcttgttccatcaaaaggacaagggatcggtgcaagca
cctgaaataagcagcaattcagttaaggatactctcgttccaaatgaaaggaaagagttt
tcaaaaaactttgaaaaaaatgacataaaagagagaggccctcctaaaaaacgaaggcag
gaagtggagagtgactctgagagtgacggtgagctgcaggctagaaagaaaatgagagtg
gagagcgagccaggagagacatcagtgctcctgcagtcagagctaatggggccttcctgc
gctatggaggacttcagggacccacagcggtggaaagagtttgccaagctggggaagatg
ccttgttactttgatcttattgaagaaaatgtgtatttaacagaaagaaagaagaacaaa
tcccatcgggatattaaaagaatgcagtgtgagtgtacacctctttctaaagatgaaaga
gctcaaggtgaagtcgcatgtggagaagattgcctcaatcgtctcctcatgattgaatgt
tcctctcgatgtccaaatggagattattgttcaaatagacggtttcagagaaagcagcat
gcagatgtggaagttatactgacagaaaagaaaggctggggtttaagagctgccaaggat
cttccttcgaacacctttgttctggaatactgtggagaggtacttgatcataaagagttt
aaagctcgggtgaaagaatatgcacggaacaaaaatatccactactatttcatggccctg
aaaaatgatgagataatagatgccactcaaaaagggaattgttctcgttttatgaatcat
agctgtgagccaaactgtgaaacccaaaagtggactgtgaatggacaactgagggttgga
ttttttaccaccaaactagttccttcaggctcagagttaacatttgactatcagttccaa
agatatggcaaagaagctcagaaatgtttctgtgggtcagctaactgccggggttacttg
ggaggagaaaacagagtcagcatcagagcagcaggagggaagatgaaaaaggagcgctct
cgaaagaaggattcggtggatggagagctagaagcactgatggaaaatggtgagggcctc
tctgataaaaaccaggttcttagtttatcccggctcatggttagaattgaaactctggaa
cagaaacttacctgtctcaagcttattcagaacacacactcgcagtcctgtctcaagtcg
tttctggaacgtcatgggttgtcgctgctgtggatctggatggcagagcttggggatggc
cgggaaagtaaccagaagcttcaggaagagattataaagactctggagcatttgcccatt
cctactaaaaatatgttggaagaaagtaaggttcttccaatcattcaacgctggtctcag
accaagactgctgtccctccattaagtgaaggtgatgggtattctagtgagaatacatca
cgtgctcacacgccacttaatactcctgatccttccatcaagctgagcacagaagtggat
acagagactcccaagaaactcgtgtttcgaaggcttaagattataagtgaaaacagcatg
gacagtgcaatctctgacgtcaccagtgaactagaatgcaaggatggtaaagaggacctt
gatcaattagaaactgtcactgtagaagaagatgatgacttgcagtcacaacagctacta
ccacaacagccgtgtgagtccaaagttgagagtgaaaccaccattgaagtcagtaaatta
cccacatctgaaccagaggctgacactgaggcagagctcaaagaaagcagtggcacaaaa
ctagaagaaactattgctgaagaaacaccgtcccaagatgaagaagagggtgtgtcggat
gttgaaagtgagagaagccaagaacctccagataaaacagtggatataagtgatttggcc
accaagctgctagatagttggaaagacctaaaggaggtgtatcgaattccaaagaaaagt
caaactgaaaaggagagcacagtaactgaacgaggaagggatgctgctgccttcagagat
caaaccgttccaaagactcctaacaggtcgagagaaagagacccagacaagccaactcag
aataaagagaaaaggaaacgaaggggctctctttccccaccctcttctgcctatgagcgg
ggaacaaaaaggccagacgacagatatgatacaccaacttctaaaaagaaagtacggatc
aaagaccgaaataaactttctacagaggagcgcaggaagttgtttgaacaagaggtagca
cagagggaggctcagaagcaacagcaacagatgcagaacttggggatgacatcaccacta
ccctttgactctctgggctataatgcctctcatcacccctttgctggctatcccccaggc
tatcccatgcaagcgtatgtggaccccagcaatcctaatgctgggaaggtgcttctgccc
acgcccagcatggaccctgtgtgctctcccgcaccttatgaccatgctcagcccttggta
ggacattccacagaatcccttgctgcccctgcatcagtgccggtggtaccccatgtggca
gcctctgtggaagtttccagttcacagtatgtagctcagaatgaaagtgtggttcaccaa
gactccagtgttcctgtaatgccagtacaagctccaggcccagtccaaggacagaattat
agtgtctgggattcaaatcaacagtctgtcagtgtacaacagcagtactcccctgcacag
tctcaagcaaccatatattatcaaggacagacatgttcaactgtctatggtgtgacatct
ccttattcacagacaactccaccaattgtgcagagttatgcccagccaaatcttcagtat
atccagggacagcagattttcacagctcacccacaaggagtggtggtgcagccaacttca
gccgtgaccacaatagttgcaccagggcagcctcagtccttacagccacctgaaatggtt
gtaacaaacaatctactggatctgccacccccctctcctccaaaaccaaaaaccattgtt
ttacctcccaactggaagacagcccgagatcctgaagggaagatctattactaccatgta
atcacaaggcagactcagtgggatcctcccacttgggaaagcccaggagatgatgccaac
cttgagcatgaagctgagatggacctgggaaccccaacatatgatgaaaaccccatgaag
acatcaaaaaagcccaagacagcagaagcagacacgtccagtgagctggcaaagaaaagc
aaggaagtattcagaaaagagatgtctcagttcattgtccagtgcctgaatccttaccgg
aagcctgactgcaaggtgggcagaatcaccacgacagaggatttcaaacaccttgctcga
aagctgactcatggagttatgaataaggagctgaagtactgtaagaaccctgaggacctg
gagtgcaatgagaatgtgaaacacaaaaccaaggagtacattaagaagtacatgcagaag
tttggggctgtttacaaacctaaagaggacactgaattagagtga

DBGET integrated database retrieval system