KEGG   Cricetulus griseus (Chinese hamster): 100765697Help
Entry
100765697         CDS       T02813                                 

Gene name
Setdb1
Definition
(RefSeq) histone-lysine N-methyltransferase SETDB1 isoform X2
  KO
K11421  [histone H3]-lysine9 N-trimethyltransferase SETDB1 [EC:2.1.1.355]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00310  Lysine degradation
cge01100  Metabolic pathways
cge04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100765697 (Setdb1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100765697 (Setdb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cge03036]
    100765697 (Setdb1)
Enzymes [BR:cge01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.355  [histone H3]-lysine9 N-trimethyltransferase
     100765697 (Setdb1)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100765697 (Setdb1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100765697 (Setdb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF5604 Tudor_4 TUDOR_5 Pre-SET MBD DUF4537 53-BP1_Tudor
Motif
Other DBs
NCBI-GeneID: 100765697
NCBI-ProteinID: XP_027249417
LinkDB All DBs
Position
1
AA seq 1284 aa AA seqDB search
MSSLPGCVSLDAATAAPDSEDMTELQQAVVEELGISMEELRQFIDEELEKMDCIQQRKKQ
LAELETWVLQKESEVAYVDQLLDDASRAVINCESLVKDFYSKLGLQYHDSSSEDEASQPT
EIIEIPDEDDDVLSIDSGDAGSRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKSSSQDL
NKGTLGQMSGELSKDGDLIVSMRILGKKRTKTWHKGTLIAIQTVGLGKKYKVKFDNKGKS
LLSGNHIAYDYHPPADKLFVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDG
YASYVTQSELYPICRPLKKTWEDIEDSSCRDFIEEYITAYPNRPMVLLKSGQLIKTEWEG
TWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASAMEKKQGGQLRTR
PNMGAVRSKGPVVQYTQDLTSTGTQFKLTEPPQPIATPAPPAALPLSPQAGDTESLESQL
AQSRKQVAKKSTSFRPGSVGSGHSSPASPTLSESVTAGKLGINQTYRSPLASVASTPTPA
APPAFHGMLERAPAEPSYRAPMEKLFYLPHVCSYTCLSRIRPMRNEQYRGKNPLLVPLLY
DFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIERYLFETGCDFLFLEMFCLDPYVLV
DRKFQPFKPFYYILDITYGKEDVPLSCVNEIDTTPPPQVAYSKERIPGKGVFINTGPEFL
VGCDCKDGCRDKSKCACHQLTIQATACTPGGQINPNSGYQYKRLEECLPTGVYECNKRCK
CDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKILTDDFADKEG
LEMGDEYFANLDHIESVENFKEGYESDVASSSDSSGVDMKDQEDGNSGSEDPEESNDDSS
DDNFCKDEDFSTSSVWRSYATRRQTRGQKENGLSEVASKDSRPPDLGPPNVPVPPAVSVG
GCKPPSSEETPKNKVASWLSCNSVSEGGFADSDSRSSFKNSERGDGRAGAGRAEAEKAST
SGLSFKDEGDNKQTKKEDPDDRNKMSVVTESSQNYGHNPPMKSDGLRRPSSKTSMPQSRR
LGASTQSNPDDILTLSSSTESEGESGISRKPTAGQTSATAVDSDDIQTISSGSDGDDYED
KKNLTGPTKRQVAVKSTRGFALKSTHGIAIKSTNMASVDKGESAPVRKNTRQFYDGEESC
YIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTELTWDYNY
EVGSVEGKELLCCCGAIECRGRLL
NT seq 3855 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccctccctgggtgcgttagtttggatgcagcaacagctgcccctgactctgaa
gacatgactgagctgcagcaggcagtggttgaagagctgggtatctctatggaggaactt
cgccagttcattgatgaagagctggaaaagatggactgtatacagcagcgcaagaagcag
ctagcagagttggagacgtgggtgctgcagaaggagtctgaggtggcttatgttgaccag
ctccttgatgatgcatccagggcagtgattaattgtgagtctttggtgaaggatttctac
tctaagctgggactgcagtatcatgacagtagctccgaggatgaagcttcccagcctaca
gaaataattgagattcctgatgaagatgatgatgtcctcagtattgattcaggtgatgct
ggaagcagaactccgaaagaccagaagctccgtgaagctatggctgccttaagaaaatca
gctcaagatgtccagaagttcatggatgctgtcaacaagaaaagcagttcccaggatcta
aataaaggaaccttgggtcagatgtctggagaactgagcaaagatggggacctgatagtc
agtatgcggattctgggcaagaagaggactaagacatggcacaaaggcacccttattgcc
atccagactgttgggctgggaaagaaatacaaagtgaaatttgacaacaaagggaagagt
ctgctgtctggcaaccacattgcctatgattatcaccctcctgctgacaagctgtttgtg
ggcagtcgcgtggtagccaaatacaaagatggaaatcaggtctggctttatgctggcatt
gtagctgagactcccaacgtcaagaacaagctcagatttctgattttctttgatgatggt
tatgcctcctatgtcactcagtcagaactgtatcccatttgccgaccattgaaaaagacc
tgggaggacatagaagacagctcctgccgagacttcatagaggaatatatcactgcctac
ccaaaccgccccatggtacttctcaagagtggccagcttattaagactgagtgggaaggc
acatggtggaaatctcgagttgaagaggtggatggcagcctagtcaggatcctctttctg
gatgacaagagatgtgagtggatctatcgaggctctacacgcctggaacccatgttcagt
atgaagacatcatcagcttctgcaatggagaagaagcaagggggacaattgagaacccgt
cctaatatgggtgctgtgaggagcaaaggtcctgttgttcagtatacacaggacctaacc
agcactggaacccagttcaagctcacggagcccccacagcccatagctacaccggccccc
cctgctgcacttcctctttccccacaagcaggtgacactgaaagcttagaaagccaactt
gctcagtcacggaagcaagtggccaaaaagagcacatcgtttcggccaggatctgtgggt
tctggccattcctcccctgcttcgcccacactcagtgaaagtgtaactgctgggaaactt
gggatcaaccagacatacagatcgcctttggcctcagtagcatctactccaacacctgca
gcccctccagccttccatggcatgttagagcgggcaccagctgagccttcctaccgagcc
cccatggagaagcttttctatttacctcatgtctgcagttacacttgtctgtcccggatc
agacccatgaggaatgaacagtaccggggcaagaatcccctcttagtaccgctgctatat
gacttccgtaggatgacagcccggcgtagagttaaccgcaaaatgggcttccatgttatc
tataagacaccctgtggtctctgtcttcggacaatgcaggaaatagaacgctaccttttt
gagactggctgtgacttcctgttcctggagatgttctgtttggatccatacgttcttgtc
gacagaaagtttcagccttttaagcctttttactatattttggacatcacctacggcaag
gaagatgttcccctgtcctgtgttaatgagattgacacaactcccccaccccaggtggcc
tacagcaaggagcgcatccctggcaagggtgttttcattaacacaggccctgaatttctg
gttggctgtgactgcaaggatgggtgtcgggataaatctaaatgtgcctgccatcagcta
actatccaagccacagcatgtaccccaggaggccaaatcaaccctaactctggctaccag
tacaaaaggcttgaagagtgtctgcctacaggggtttatgagtgtaacaaacgctgcaaa
tgtgacccaaacatgtgcacaaatcgcttggtgcaacatggactacaggttcgactacag
ctatttaagacacagaacaagggctggggtatccgctgcttggatgacattgccaaaggc
tcttttgtctgtatttatgcaggcaaaatcctgacagatgattttgcagacaaagaaggg
ctggagatgggtgatgagtactttgcaaatctggaccacattgaaagtgtggagaatttt
aaggaaggatatgagagtgatgtcgccagttcatctgacagcagtggggtggacatgaag
gaccaggaagatggcaacagcggttcagaggatcctgaagagtccaatgatgacagctct
gatgataacttctgtaaggatgaagacttcagcaccagctcagtgtggcgtagctatgct
acccggagacagactcggggtcagaaggaaaacggactgtctgaggtggcttccaaggac
tcccgtcccccagaccttgggcctccaaatgttcctgtccctcctgcagtatctgtaggg
ggctgcaagccaccttcatctgaagagacccccaagaacaaggtggcctcgtggttgagc
tgcaacagtgtcagtgaaggtgggtttgctgattctgacagccgttcttccttcaagaat
agtgagcgtggagatggccgggctggggcaggccgggcagaggctgagaaggcctctacc
tcaggattgagcttcaaggatgaaggagacaataagcagactaagaaagaggatcctgat
gaccgaaacaagatgtcagtagtcactgaaagctctcagaattatggacacaatcctcct
atgaagtctgatgggcttcgccgaccatctagtaaaacttctatgccccaaagtcggcga
cttggggcttctactcagtccaaccctgatgatatcctgacactgtccagcagcacagaa
agtgagggggaaagtggaatcagccgaaagcccactgctggtcagacttctgccacagct
gttgacagtgatgacatccagaccatctcctctggctctgatggcgatgactatgaggac
aaaaaaaacttgactggtccaacgaagcgccaggtggcagtaaaatcaacccgaggcttt
gctcttaaatcaacccatgggattgctattaaatcaaccaacatggcttctgtggacaag
ggggagagtgcaccagttcgtaagaacacacgccagttctatgatggtgaagagtcttgc
tacatcattgatgccaaacttgaaggcaacctaggccgctacctcaatcacagttgtagc
cccaacctgtttgtccagaatgtcttcgtggatactcacgatcttcgcttcccttgggtg
gccttctttgccagcaagaggatccgggctggaacagagcttacttgggactacaactac
gaagtgggcagtgtggaaggcaaagagctgctgtgctgctgtggggccattgagtgcaga
ggacgtcttctctaa

DBGET integrated database retrieval system