KEGG   Cricetulus griseus (Chinese hamster): 100765882Help
Entry
100765882         CDS       T02813                                 

Gene name
Gad1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00250  Alanine, aspartate and glutamate metabolism
cge00410  beta-Alanine metabolism
cge00430  Taurine and hypotaurine metabolism
cge00650  Butanoate metabolism
cge01100  Metabolic pathways
cge04727  GABAergic synapse
cge04940  Type I diabetes mellitus
Module
cge_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    100765882 (Gad1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100765882 (Gad1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100765882 (Gad1)
   00430 Taurine and hypotaurine metabolism
    100765882 (Gad1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100765882 (Gad1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    100765882 (Gad1)
Enzymes [BR:cge01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     100765882 (Gad1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS DegT_DnrJ_EryC1 OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 100765882
NCBI-ProteinID: XP_027276018
LinkDB All DBs
Position
6
AA seq 593 aa AA seqDB search
MASSTPSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEKS
RLVSAFRERQSSKNLLSCENSDPGARFRRTETDFSNLFAQDLLPAKNGEEQTVQFLLEVV
DILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGVR
TGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIIGWSS
KDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAAL
GFGTDNVILIKCNERGKIIPADLEAKIIEAKQKGYVPLYVNATAGTTVYGAFDPIQEIAD
ICEKYNLWLHVDAAWGGGLLMSRKHRHKLSGIERANSVTWNPHKMMGVLLQCSAILVKEK
GILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQIN
KCLELAEYLYAKIKTREEFEMVFDGEPEHTNVCFWYIPQSLRGVPDSPERREKLHRVAPK
IKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atggcatcttccactccttcgtctgcaacctcttcgaacgcgggagcagatcctaatact
accaacctgcgccctacaacatatgatacttggtgtggcgtagcccatggatgcaccaga
aaactgggcctgaagatctgtggcttcttacaaaggaccaatagcctggaagagaagagc
cgccttgtgagtgccttcagggagaggcagtcctccaagaacctgctttcctgtgaaaac
agtgacccgggtgcccgcttcaggcgcacagagactgacttctccaacctgtttgctcaa
gatctgcttccagccaagaatggggaggagcaaacggtgcagttcctgctggaggtggtg
gacatactcctcaactatgtccgcaagacgtttgatcgctccaccaaggtgttggacttc
caccacccacaccagttgctggaaggcatggagggctttaatttggagctgtctgaccac
cctgagtctctcgagcagatcctggttgactgcagagacaccctaaagtatggggttcgt
acaggtcatcctcgatttttcaaccagctctctactggtttggatatcattggtttagct
ggcgagtggctgacatcaactgccaataccaatatgtttacatatgaaattgcaccggtg
tttgttctcatggaacagataacacttaagaagatgagagagatcattggatggtcaagt
aaagatggtgatgggatattttctcctgggggagccatatccaacatgtacagcatcatg
gctgctcgctacaagtactttccggaagttaagacaaagggcatggcggctgtgcccaaa
ctcgtcctcttcacctcagaacacagtcactattccataaagaaagcgggggctgcactt
ggctttggcactgacaatgtgattttgataaagtgcaatgaaagggggaagataattcca
gctgatttagaggcaaaaattattgaagccaagcaaaagggatatgttcccctctatgtc
aatgcaactgcaggcacaactgtttatggcgcttttgatccaatacaggagattgcagac
atatgtgagaaatacaacctttggctccatgttgacgctgcctggggtggtgggctgctc
atgtcccggaagcaccgccacaaactcagtggcatcgaaagggccaattcggttacctgg
aacccacacaagatgatgggcgtgttgctacagtgctcagccattctggtcaaggaaaag
ggtatactccaaggatgcaaccagatgtgtgcaggctacctcttccaaccagacaagcag
tatgatgtctcctatgatactggggacaaggcgattcagtgtggccgccatgtggacatc
ttcaagttctggctgatgtggaaagcaaagggtactgtgggatttgaaaaccagatcaac
aaatgcctggagttggctgaatatctctatgccaagattaaaaccagagaagaatttgag
atggtttttgatggtgagcctgagcacacaaacgtctgtttctggtacattccacaaagc
ctgagaggggttccggatagccctgagcgaagagaaaaactgcacagggtggctcccaag
atcaaagccctgatgatggagtcgggcacaaccatggttggctaccagcctcagggggac
aaagccaacttcttccggatggtcatctccaacccagctgccacccagtctgacatcgac
ttcctcattgaagagatagagaggctgggccaggacctgtaa

DBGET integrated database retrieval system