KEGG   Cricetulus griseus (Chinese hamster): 100766256
Entry
100766256         CDS       T02813                                 

Gene name
Atr
Definition
(RefSeq) serine/threonine-protein kinase ATR
  KO
K06640  serine/threonine-protein kinase ATR [EC:2.7.11.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge03460  Fanconi anemia pathway
cge04110  Cell cycle
cge04115  p53 signaling pathway
cge04218  Cellular senescence
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:cge00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    100766256 (Atr)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100766256 (Atr)
   04115 p53 signaling pathway
    100766256 (Atr)
   04218 Cellular senescence
    100766256 (Atr)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100766256 (Atr)
   05170 Human immunodeficiency virus 1 infection
    100766256 (Atr)
   05165 Human papillomavirus infection
    100766256 (Atr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cge01001]
    100766256 (Atr)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cge03400]
    100766256 (Atr)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100766256 (Atr)
Protein kinases [BR:cge01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   100766256 (Atr)
DNA repair and recombination proteins [BR:cge03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100766256 (Atr)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT UME FATC Mad3_BUB1_I THP2
Other DBs
NCBI-GeneID: 100766256
NCBI-ProteinID: NP_001278986
UniProt: N0DNU5
LinkDB
AA seq 2636 aa
MGDHGLELASMIPALRELGSATPEEYNTVVQKPRQILCQFIDRILTDVNVVALELVKKTD
AQPTSVMLLDFIQHIMKSSPLMFVNVNGSQGQNEAKDSCIEFSHWIITRLLRIAATPSCH
MLHKKICEVICSLLFLFKSKNPTIFGILTRELLYLFEDLIYLHKRNAVDNVIEWPVVASR
FLSRLDEYMGCLQPAPLQFMNMQNVEFIEVTLLMVLIHIVPTVFFRRQELLLWQIGCALL
EHGSPKIRSLAISLLTELFELGGLPAQPASTFFSLFLELLQHLVGMDADQLKLYEEPLSK
LVKTLFPFEAEAYRNIEPVYLNVLLEKLCVMFEDRVLMRLKSDLLKASLCHLLQYFLKFV
PAGYESALQVRKIYVTNICRALVDVLGVQKHIGYLLGPFYAALRMESIEIIEGIQCQTQQ
ENLSDLNDEVSPKRRRLSSSLNSSKRPSRQSEEITRVDMDKKSILWNVLKQKAESLQISL
ECGTLRNSVAEKLEGITIVLQLTALCTVHCSHQDIDSQNFKDCQQKYKKKSPVMITWMSL
DFYTKVLKSCRSLLGSVQKLELELVIDNMVRIYDALMYMQVKSSFEDHILEELCGMLSLP
WIYSHSDDNSLKLTTFATNLLPLSQRICDSYSPQAQSQCVFLLTLFPRRIFLEWRTAVYN
WALMSSHEVIRASCVKGFFILLQQQNSCNQIPKMLIDRVKDDSDIVKKEFASILGQLVCT
LHGMFYLTSSSVEPLFEHVDLFCKNLKATPQLECSSSQVRASVCKPFLFLLAEKTPSPVK
LAFIDNLHHLCKHLDFQEDETEVKAVLGTLLNLMEDPDKDVRVAFSGNIKYILESLDSED
GFIKELFVLRMKEAYTHAQISRNNELKDTLILTTGDIGRAAKGDLIPFALLHLLHCLLSK
SASVSGAAYTEIRALVAAKSVKLQNFFSQYKKPICQFLVESLHSSQMTALPGTPCQTAEM
RKQDVAHHREMALNTLSEIANVFDFPDLNRFLTRTLQVLLPDLAAKASPAASALIRTLGK
QLNVNRREILINNFKYIFSHLVCSCTKDELERALHYLKNETEIELGSLLRQDFQGLHNEL
LLRIGEHYQQVFNGLSILASFASSDDPYQGPRDITSPELMADYLQPKLLGILAFFNMQLL
SSSVGIEDKKMALNSLMSLMKLMGPKHVSSVRVKMMTTLRTGLRFKDDFPELCCRAWDCF
VRCLDHAYLGPLLSHVIVALLPLIHMQPKETAAIFHYLIIENRDAVQDFLHEIYFLPDHP
ELEKIKAILQEYRKETSESTDLQTTLQLSMKAIQHENVDVRIHALTSLKETLHKNQEKLI
KYATDSETVEPVISQLVTVILKGCQDANSQARLLCGECLGELGAIDPGRLDFSTTETQGK
DFTFVSGVEDLSFAYGLLMELTRAYLAYADNSRAQDSAAYAIQELLSIYDCREIQSNGPG
HQLWKRFPEHVREILEPHLNTRYKSSQKSTDWSGVKKPIYLSKLGNNFAEWSSSWAGYLI
TKVRHDLASKIFTCCSIMMKHDFKVTIYLLPHILVYVLLGCNQEDQQEVYAEIMAVLKHD
DQHAISTQDSASDLCQLSTQTVFSMLDHLTQWARHKFQALNAEKHPQNKLKGVSNVNLED
YQSVTRFLDLIPQDTLAVASFRSKAYTRAVMHFESFITEKKQNIQKHLGFLQKLYAAMHE
PDGVAGVSAIRKAEPSLKEQILEHESIGLLRDATACYDRAIQLEPDQIIHYHGVVKSMLG
LGQLSTVITQVNGVHANRSEWTDELNTYRVEAAWKLSQWDLVENYLAGDGKSTTWSVRLG
QLLLSAKKRDTTAFYDTLKLVRAEQIVPLSAASFERGSYQRGYEFIVRLHMLCELEHSIK
PLFHKSPGDTCNEDSLNWAARLEMTQNSYRAKEPILALRRALLSLNKRPDYNEMVGECWL
QSARVARKAGHHQTAYNALLNAGESRLAELYVERAKWLWSKGDVHQALIVLQKGVELCFP
ENKSPTESKHMLIHGRATLLVGRFMEETANFESNAIMKKYKDVTLFLPEWEDGHFYLAKY
YDKLMPMVTDNKMEKQGDLIRYIVLHFGRSLQYGNQFIYQSMPRMLSLWLDFGAKAYEWE
KGGRSDRVQMRSDLAKINSVLTEHTNRLAPYQFLTAFSQLISRICHSHDEVFVVLMEIIA
KVFLAYPQQAMWMMTAVSKSSYPMRVNRCKEILTKAIHMKKSLEKFVGDATRLTDKLLEL
CNKSVDGSNSTLSMSTHFKMLKKLVEDPTFSEILIPLQSVMIPTLPSILGAHANHDPFPG
HWAYLAGFDDVVEILSSLQKPKKISLKGSDGKFYIMMCKPKDDLRKDCRLMEFNSLINKS
LRKDAESRRRELHIRTYAVIPLNDECGIIEWVNNTAGLRPILTKIYKEKGVYMTGKELRQ
CMLPKSAALSEKLKVFQELLLPRHPPVFHEWFLRTFPDPTSWYSSRSAYCRSTAVMSMVG
YILGLGDRHGENILFDSFTGECVHVDFNCLFNKGETFEVPEIVPFRLTHNMVNGMGPMGT
EGLFRRACEVTLRLMRDQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPLNETGEVVNEKA
KTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGWTPYM
NT seq 7911 nt   +upstreamnt  +downstreamnt
atgggcgaccacgggctggagctggcgtccatgatccccgccctgcgggagctgggcagt
gctactccagaggaatataataccgttgtacagaaaccaagacaaattctctgccagttc
attgaccgaatccttacagatgtaaatgttgttgctctagaacttgtaaagaaaaccgat
gctcagccaacctctgtgatgttacttgatttcatccagcacatcatgaagtcttctcca
cttatgtttgtaaatgtgaatggaagccagggacaaaatgaggccaaagacagttgtatt
gaattcagtcattggatcattacaagacttttacggattgcagcaactccatcctgccac
atgttacacaagaaaatatgtgaagttatctgctccttattatttctttttaaaagcaag
aatcctactatttttgggatactcacaagggaattactttacctttttgaagacttaatt
tacctccacaaaagaaatgcagtggataatgttatagaatggccagtggttgctagtaga
tttttaagccgattggatgaatacatgggatgtttacagccagctcctttgcaattcatg
aacatgcaaaatgtagaatttattgaagtcactttattaatggttcttattcatattgtt
ccaactgtgttttttagacgacaagaattgttactgtggcaaataggctgtgctctgcta
gagcatggtagtcccaaaatcagatctttagcaattagccttttaactgaactctttgag
cttggaggattaccagcacagccagccagcacttttttcagcttatttttggaattgcta
caacaccttgtaggaatggatgctgaccaattgaaactgtatgaagagccgttgtcaaag
ctggtaaagacactattcccctttgaagcagaggcttatagaaatattgaacctgtctac
ttaaacgtgctgttggaaaaactctgtgtcatgtttgaagatagagtgcttatgcggctc
aagtctgatttgctgaaagcatctttgtgtcatttactgcagtatttccttaaatttgtg
ccagctgggtatgaatcggctttacaggtcagaaagatatatgtgacaaatatttgtaga
gcgcttgtagatgttcttggagttcagaaacatattgggtacttgttgggaccattttat
gcagccttgagaatggaaagtatagaaattatcgagggaattcagtgtcaaactcaacag
gaaaatctcagcgatcttaatgatgaggtgtcaccaaagaggcgtagactcagctcttct
ctcaactcttccaaaaggccatccagacagtctgaagaaattacccgtgtggatatggac
aaaaagagcatattatggaatgtactgaagcagaaagctgaatcccttcagatttccctt
gaatgtggtactctaaggaattctgttgctgagaagttagaaggaatcactattgtatta
cagctgactgctctctgcactgttcactgttctcatcaagacatagatagccagaatttc
aaggactgtcaacaaaaatataagaagaaatctccagtaatgataacttggatgtctttg
gatttttatacaaaagtgcttaagagctgtaggagtttgttaggctctgttcagaaactt
gaactggaattagtcattgataacatggtgagaatttatgatgctttgatgtatatgcaa
gtaaaaagttcatttgaggatcatattctggaagaattatgtggaatgctttcacttcca
tggatttattcccattcggatgataactctttaaagttgactacatttgctactaatctt
ctgccattaagccagagaatttgtgatagttattctccacaggcacagtcacaatgtgtg
tttcttctgactctgtttccgagaagaatattccttgaatggagaacagcagtttataat
tgggccctgatgagctcccatgaagtaatccgggctagttgtgttaaaggattttttatc
ttattgcagcagcagaattcttgtaaccaaattcccaagatgcttatagatagagtcaaa
gatgattctgacattgtcaaaaaagaatttgcttctatccttggtcagcttgtctgtact
cttcatggcatgttttatttgacaagttcctcagtagagcctctctttgaacatgtggac
ctgttctgtaagaacctgaaagccactcctcagctcgaatgctcatcttctcaagtacga
gcttctgtctgcaagccgttccttttcttgttggcagaaaaaacgcctagtccagtaaaa
cttgctttcatagacaatctgcatcatctttgtaagcatcttgattttcaagaagatgaa
acagaggtcaaagcagttcttgggactttattgaatttaatggaggatccagacaaggat
gttagagttgcttttagtggaaatattaagtatatattggaatctttggactctgaagat
ggattcataaaggagctttttgttttaagaatgaaggaagcatatacacatgcccaaata
tcaagaaataacgaactgaaggataccttgattcttacaactggggacattggaagggca
gcaaaaggagatttgataccttttgcactcttgcacttactgcattgtttgttgtctaag
tcagcatccgtctctggagcggcgtacacagagattcgagcactagttgcagctaaaagt
gttaaactgcaaaattttttcagccagtataagaaacccatctgtcagtttttggtagaa
tctctccactccagtcagatgacagcactcccaggtactccttgccagactgctgagatg
agaaaacaagatgtagctcaccacagagaaatggctttaaataccttgtcagaaattgcc
aatgtttttgactttcctgatcttaatcgtttcctaactaggacattacaagttctactg
cctgatcttgctgccaaagcaagccctgcagcatctgctctcattcgaactttaggaaaa
caattaaatgtcaatcgtcgagagattttaataaataacttcaaatatattttttctcat
ttggtttgttcttgtaccaaagatgaattggaacgtgcccttcattatctaaagaatgaa
acagaaattgagctggggagtctgttaagacaggattttcagggattgcataatgaatta
ttactacgtattggagaacattatcaacaagttttcaatggtttgtcgatacttgcctca
tttgcatctagtgatgatccatatcagggaccacgagatattacatcacctgaactgatg
gctgattatttgcaaccaaaattgttgggcattcttgccttttttaatatgcagttactg
agctccagtgttggcattgaagataagaaaatggctttgaatagtttgatgtctttgatg
aagttgatgggacctaaacatgttagttctgtgagagtaaaaatgatgaccacactgaga
actggccttagattcaaggatgattttcctgagttatgttgcagagcatgggactgcttt
gttcgttgcctggatcatgcttacctgggccccctgctcagtcatgtcatagtggctttg
ttacctctcatacacatgcagccaaaagaaactgctgctatctttcactacctcatcatt
gaaaacagggatgctgtgcaagattttcttcatgaaatatattttttgcctgatcatcca
gaattagaaaagataaaagcaattcttcaggaatatagaaaggagacatctgagagtact
gaccttcaaaccactctccagctatccatgaaagcaattcaacacgaaaatgtagatgtt
cgtatccatgctcttaccagcttgaaggaaaccttacataaaaatcaggaaaaactgata
aagtatgcaactgatagtgaaactgtggagcctgttatctcacagctggtgacggtaatt
ttgaagggctgccaggatgcaaactctcaagctcgcttactgtgtggggaatgtttagga
gaattgggggcaatagatccaggacgattagatttctcaacaacagaaactcagggaaaa
gattttacatttgtgtctggagtagaagatttaagctttgcttatggattgctgatggaa
ctaacaagagcttaccttgcgtatgcagataacagccgagcacaagattcagctgcttat
gctattcaggaattactttctatttatgactgtagagagatacagagcaatggcccaggt
caccaactgtggaagagatttcctgagcatgtccgggaaatattagaacctcatctcaat
actagatataagagttcccagaaatcaacagattggtctggagtaaagaagccaatttac
ttaagtaaattaggtaataactttgcagaatggtcatcatcttgggcaggttatcttata
acaaaggttcggcatgatcttgccagtaaaatctttacatgctgtagcataatgatgaag
catgatttcaaggtcaccatctatcttcttccacatattctagtgtatgtcttgttgggt
tgtaatcaagaagatcagcaagaggtttatgcagaaattatggcagtgctaaagcatgat
gatcagcatgccatcagtacccaggacagtgcatctgatctctgtcaattgagtacacag
accgtgttctctatgcttgaccatctcacccaatgggcaaggcacaaatttcaggcgtta
aatgctgagaaacatccacaaaacaaactaaaaggagtatcaaatgtgaatcttgaagac
taccagagtgtaactcgttttctagacctcatacctcaggatactctggctgtagcttcc
tttcgctccaaagcatacacacgagctgtaatgcactttgaatcatttattacagaaaag
aagcaaaatattcaaaagcaccttggatttctacagaaattgtatgctgctatgcatgag
ccagatggagtggctggagtaagtgcaattcgaaaagcagagccatccctaaaggaacag
atccttgaacatgaaagtattggcttgctgagggatgccactgcctgttatgacagggct
attcagctagaaccagaccagatcattcattatcatggtgtggtgaagtccatgttaggt
cttggtcagctgtctactgtaatcactcaggtgaatggagtgcatgccaacaggtctgaa
tggacagatgaattaaacacatacagagtagaagcagcttggaaactgtcacagtgggat
ttggtggaaaactatttggcaggagatgggaaatctacaacatggagtgtcagactggga
cagctactgttgtcagccaaaaaaagagataccacagctttctatgacacattgaaacta
gtgagagcagaacaaattgtacctctttcagctgcaagctttgaaagaggctcttaccaa
cgaggatatgaatttattgtgagattgcacatgttgtgtgagttggagcatagcatcaaa
ccactttttcacaaatctccaggtgacacttgtaatgaagactctctgaactgggcagct
cggctagaaatgacccagaattcctatagagccaaggagcctatcctggccctccggaga
gctttattaagcctcaacaaaaggccagattacaacgaaatggttggagaatgctggctg
cagagtgccagagtagctagaaaggctgggcaccatcagacagcctacaatgctctcctt
aatgcaggagaatcgagacttgccgaactgtatgtggaaagggcaaaatggctgtggtcc
aagggtgatgttcaccaggcacttattgtacttcagaagggtgttgaattatgttttcct
gaaaataaatccccaactgagagtaagcacatgctaatccatggacgagctacactgcta
gttggccggtttatggaagaaacagctaattttgaaagcaatgcgattatgaagaaatat
aaggatgtaactttgtttctgccagagtgggaagatgggcatttctaccttgccaagtac
tatgacaaattgatgcccatggtaacagacaacaaaatggaaaagcaaggtgatctcatc
cgatatatagtcctgcattttggaagatctcttcagtatggaaatcagttcatatatcag
tcaatgccacgaatgttatcactatggcttgattttggtgctaaggcatatgaatgggaa
aaaggtggtcgttctgatcgtgtgcaaatgagaagtgatttggctaaaataaatagtgtt
ctcacagagcacacaaatcggttagctccgtatcagtttttgactgctttttcacagttg
atttctcgaatttgtcattctcacgatgaagtttttgttgtcttgatggaaataatagcc
aaggtatttctggcctaccctcagcaagcaatgtggatgatgacagctgtgtcaaagtcg
tcttatcccatgcgtgtgaacagatgcaaggaaattcttactaaagctatccatatgaaa
aagtctttagaaaagtttgttggagatgcaactcgactaactgacaagctactagaattg
tgcaacaaatcggttgatggaagtaattccacattaagcatgagcactcactttaaaatg
cttaaaaagctggtagaagacccaacatttagtgaaatcctcattcctttgcagtcagtc
atgatccctactcttccgtcaattttgggtgcccatgctaatcatgacccatttcctggc
cattgggcctatcttgcaggcttcgatgatgtggtagaaattctttcttctcttcagaaa
ccaaagaagatctctttaaagggctcagatgggaagttctacatcatgatgtgtaaacca
aaagatgacttgaggaaagactgtagactaatggaattcaattctctgattaacaagagc
ttaagaaaagatgcagaatcacgtcgaagagaacttcatatccgaacatatgcagttatt
ccactgaatgatgagtgtgggattattgagtgggtgaacaacactgctggcttgagacct
attcttaccaaaatatataaggaaaagggagtgtatatgacaggaaaggaacttcgccag
tgtatgctaccaaagtcagcagctttatctgaaaaactcaaagtattccaagagctactc
ctgcccaggcacccccctgtttttcatgagtggtttctgagaacattccctgatcctaca
tcatggtatagtagtagatctgcatactgtcgttctactgcagtcatgtcaatggttggc
tatatcctagggcttggagatcggcatggtgaaaacattctttttgattctttcaccggt
gaatgtgtacatgtagacttcaactgtctttttaataagggagaaacttttgaagttcca
gaaattgtaccatttcgcctgactcataatatggttaatggaatgggtcctatgggaaca
gagggtctgtttcgaagagcatgtgaagttacactgaggctgatgagggatcagagagaa
cctttaatgagtgtcttaaagacttttctgcatgatcctcttgtggaatggagtaaacca
gtgaaaggacattccaaagcaccactgaatgaaactggggaagttgtcaatgaaaaggcc
aagacccatgttcttgacattgaacaacgactgcaaggtgtaatcaagacccgaaataga
gtaacaggattgccattatctattgaaggacatgtgcattacctcatacaagaagctact
gatgaaaacttactatgtcagatgtaccttggttggaccccatatatgtaa

DBGET integrated database retrieval system