KEGG   Cricetulus griseus (Chinese hamster): 100766459Help
Entry
100766459         CDS       T02813                                 

Gene name
Map3k14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04010  MAPK signaling pathway
cge04064  NF-kappa B signaling pathway
cge04210  Apoptosis
cge04380  Osteoclast differentiation
cge04625  C-type lectin receptor signaling pathway
cge04660  T cell receptor signaling pathway
cge04668  TNF signaling pathway
cge04672  Intestinal immune network for IgA production
cge05166  Human T-cell leukemia virus 1 infection
cge05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100766459 (Map3k14)
   04064 NF-kappa B signaling pathway
    100766459 (Map3k14)
   04668 TNF signaling pathway
    100766459 (Map3k14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100766459 (Map3k14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100766459 (Map3k14)
   04660 T cell receptor signaling pathway
    100766459 (Map3k14)
   04672 Intestinal immune network for IgA production
    100766459 (Map3k14)
  09158 Development
   04380 Osteoclast differentiation
    100766459 (Map3k14)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    100766459 (Map3k14)
   05169 Epstein-Barr virus infection
    100766459 (Map3k14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cge01001]
    100766459 (Map3k14)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100766459 (Map3k14)
Protein kinases [BR:cge01001]
 Serine/threonine kinases: STE group
  Other
   100766459 (Map3k14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Herpes_pp38
Motif
Other DBs
NCBI-GeneID: 100766459
NCBI-ProteinID: XP_003504581
UniProt: G3HLN2
LinkDB All DBs
Position
7
AA seq 564 aa AA seqDB search
MGRQLSPRGPGRPTWSHLAWTSLPGASPASVHRIPRGPAGCRPQPVSHPDSQSSVFQVRL
EVFRAEELMACAGLTSPRIVPLYGAVREGPWVNIFMELLEGGSLGQLIKQKGCLPEDRAL
YYLGQALEGLEYLHIRRILHGDVKADNVLLSSDGSRAALCDFGHALCLQPDGLGKSLLTG
DCIPGTETHMAPEVVMGKPCDTKVDIWSSCCMMLHMLNGCHPWTQYFRGPLCLKIASEPP
PVREIPPSCAPLTVQAIQEGLRKEPGHRASAMELRGKVGQALQQVGGLKSPWKGEYKEPR
PPPPDQATCHQTPPRENPPAKASTDGASEPRPPLPPEPPEQSRAPAPNLSKEESGTWEPL
PLSSLEPAPAKGPSFPDRRATFPELELQQLEIELFLNSLSQPFSLEEQEQILSCLSIDSL
SVSEDSEKNPSKASQSSRDTLSSGVHSWSSQTEARSSSCNMVLARGRPTDTPSYFNGVKV
QIQSLNGEHLHIREFHRVKVGDIATGISSQIPATAFSLVTKDGQPVHYDMEVPDSGIDLQ
CTLAPDGSFAWSWRVKHGQLENRP
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgggcagacagcttagcccccgagggcctggcaggcctacctggtcccacttggcctgg
acatcactgccaggagcatcaccagcctctgtgcatagaataccaaggggaccagcagga
tgcagaccccagcctgtctcccaccctgactcccagtcctctgtctttcaggtacggctc
gaggtgttccgggcagaggagctgatggcttgtgctgggctgacctcgcccagaattgtc
cctctctatggagccgtgcgggaaggaccttgggtcaacatcttcatggagctgctagaa
ggtggctcactaggccagctcataaagcagaagggctgtctgccagaagaccgagcccta
tactacttgggccaggctctggagggactggaatacctccatatacgaaggattctgcat
ggtgatgtcaaagctgacaacgtgctcctgtccagtgatggaagccgagctgccctctgc
gactttggccatgccttgtgcctacaacctgacggcctaggaaaatccttgctcacgggg
gactgcattcctgggacagaaacccacatggcccctgaagtcgtgatggggaagccctgt
gacaccaaggtggacatctggagcagctgctgcatgatgctccacatgctcaacggctgc
cacccctggactcagtacttccgaggcccgctctgtctcaagattgccagtgaacctcca
cctgtgagggagattccaccttcctgcgcacccctcacagtccaagccatccaggagggg
ctgaggaaagagccgggccaccgagcttctgccatggagcttcggggaaaggtgggccag
gcattacagcaagtgggaggtctgaaaagcccttggaaaggagaatataaagaaccaaga
cctccacctccagaccaagccacctgccaccagacccctccgagggagaacccaccagcc
aaggccagcacagacggggcctctgagcctcggcctcctctaccgccagaaccaccagaa
cagagcagagctccagctccaaacctgagcaaggaggagtctggcacatgggaacccttg
cctttgtcctccctggagccagcccctgccaagggccccagcttcccagaccggagggca
accttcccagagctggagctgcaacagctagagatagaactgtttctcaacagtctgtcg
cagccgttttctctggaggaacaggaacagattctctcatgcctcagcatcgacagcctc
tcagtgtcagaggacagtgaaaagaacccatcaaaggcctctcagagctcacgtgacacc
ctgagttccggcgtgcactcatggagcagccagacagaggcaagaagttccagctgcaac
atggtgctggcccggggacggcccacagatactccaagctacttcaatggtgtcaaggtc
caaatacagtctctcaatggcgaacaccttcacatccgggaattccaccgggtcaaggtg
ggagacattgcaactggcatcagcagccagatcccagccacagccttcagcttggtgacc
aaagatggacagcctgttcactatgacatggaggtgccagactcaggcatcgacctgcaa
tgcaccctggcccctgatggcagctttgcctggagctggagggtcaagcatggccaactg
gagaaccggccctag

DBGET integrated database retrieval system