KEGG   Cricetulus griseus (Chinese hamster): 100766856Help
Entry
100766856         CDS       T02813                                 

Gene name
Lct
Definition
(RefSeq) lactase-phlorizin hydrolase isoform X1
  KO
K01229  lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00052  Galactose metabolism
cge01100  Metabolic pathways
cge04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100766856 (Lct)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100766856 (Lct)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cge03110]
    100766856 (Lct)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.62  glycosylceramidase
     100766856 (Lct)
    3.2.1.108  lactase
     100766856 (Lct)
Chaperones and folding catalysts [BR:cge03110]
 Intramolecular chaperones
  Others
   100766856 (Lct)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 100766856
NCBI-ProteinID: XP_027273540
LinkDB All DBs
Position
5
AA seq 1926 aa AA seqDB search
MDLPWTALFLSTVLLSLSCQGTDWESDRNFISAAGPITNDLVLNLNYPLGIQGSDLVAGN
KDIYVCQQPLPSFLPQYFSSLHTSQVTHYKVLLSWAQLLPTGSPKNPDWEAVRCYRQLLQ
SLKAAQLQPMVVLCHQTPSTSSTIQRNFADLFADYATFAFQSFGDLVEIWFTFNDLEKAI
LDLPHQDSKASALQTLSNAHRKAFEVYHRKFSSQGGRLSVVLKAEDIPELLRAPSSAALT
KESVDFLSLDLTFECQSVATLPQKLSELQNIEPKMKVFIYALKFQDCPSTGMSPSSLLFS
LFEAINKEQVQTVGFDINAFLSCPSSSEESPSCSLTERLALQTETAAVPSSPVSAYQRVW
AAFANQSRAERDAFLQDVFPEGFLWGVSTGAFNVEGGWAEDSRGPSIWDHYSNPNVPEGQ
ATAKVASDSYHKPASDVALLRGLRAGVYKFSISWSRLFPTGQKSSPNLQGVTYYNRLIDS
LLDSHIEPMATLFHWDLPQALQDQGGWQNESVVDAFLDYAAFCFSTFGDRVKLWVTFHEP
WVISYAGYGTGQHAPAISDPGVASFKVAHLILKAHARTWHHYDLHHRQQQQGRVGIVLNS
DWAEPLDRESPQDLAAAERFLHFMLGWFAHPIFVDGNYPTTLRAQIQHINQQCGGPLAQL
PEFTAEEKQLLKGSADFLGLSHYTSRLISKAGQQTCIPSYDNIGGFSQHVDPTWPQTASP
WIRVVPWGIRRLLGFASMEYTKGRVPIFLAGNGMPVGEGADFLDDSVRVNYFNLYINEVL
KAVKEDLVDVRSYIARSLIDGFEGPPGYSQRFGLYHVNFSDSSRPRTARKSAYFFTNIIE
KNGFPAERIRRNPLPMRTGFTSRATTVLNFPSEVPSKAKIVWEKFSNQPKFERDLFYHGT
FRDDFLWGVSSSAYQIEGGWDADGKGPSIWDNFTHTPGNNVKDNATGDIACDSYHQLDAD
LNILRALKVKAYRFSISWSRIFPTGRNDSINTPGVDYYNRLIDGLVKSNIFPMVTLFHWD
LPQALQDIGGWENPSLIELFNSYADFCFRTFGDRVKFWMTFNEPLYLALLGYGSGVFPPN
VQDPGWAPYRVSHVVIKAHARVYHTYAEKYRQEQSGVISLSLNTHWVEPKNPGLQRDVEA
ADRMLQFSLGWFAHPIFRNGDYPDAMKWNVGNRSELQHLAESRLPSFTEEEKAYIMGTAD
VFCLNTYSSEFVQHSTPRLNPPSYDDDRELTVSSMDSSLISTTMHAAVPWGMRRLLNWIK
EEYGNIPIYITENGQGLDNPTLDDTQRIFYHKTYINEALKAYRLDGVDLRGYSAWSLMDN
FEWLSGYTVKFGLYHVDFDQVNRPRTARASARYYTEVITNNGMPLAKEDEFLYGEFPKGF
IWSAASAAYQIEGAWRADGKGLSIWDTFSHTPLKIENNDNGDVACDSYHKIAEDVMALQY
LGVSHYRFSISWPRVLPDGTTKFINEAGLNYYARFIDALLAAGITPQVTMYHWDLPQALQ
DIGGWENETIVQLFREYADVLFQKLGDKVKFWITLNEPFVIAAHGYGSGVSAPGISFRPG
TAPYTAGHNLIKAHAEAWHLYNDKYRASQKGVISITISSDWAEPRDPSKQEDIEAARRYV
QFMGGWFAHPIFSNGDYPEVMKTRILERSLAAGLNKSRLPEFTENEKMRIKGTFDFFGFN
HYTTVLAYNLNYPAAISSFDADRGVASIADSSWPDSGSFWLKVTPFGFRRILNWLKEEYK
NPPIYVTENGVSRRGVPELNDTDRIYYLRSYINEALKAVQDKVDLRGYTLWSVMDNFEWA
TGFAERFGVHFVNRSDPSLPRIPKASANFYASVVRCNGFPDPAQGPHPCLYQPEEAGPTG
SPVKADVPFLGLMLGKTEAQTALYVLFALLLLAVCSLAFLFYKYCKRSKQRETQPNHHNL
SPISSF
NT seq 5781 nt NT seq  +upstreamnt  +downstreamnt
atggatctgccttggacagcactcttcctgagcactgtcctcctgagtctgtcatgccag
gggactgactgggaatctgacagaaattttatttcagctgctggtcctattacaaatgac
ttagtgcttaacctgaactatccactgggaatacagggctctgatttggtagctggtaac
aaggacatctacgtctgccagcagccattgccctccttcttgccgcagtacttcagcagt
cttcacaccagccaggtcacccattacaaagtacttttatcatgggcacagcttctccca
acaggaagccccaagaatccagactgggaagcagtgcggtgctaccgacaacttctgcag
tccctgaaggctgcccagcttcagcccatggtggtcctgtgtcaccagactccatccacc
agcagcaccattcagagaaactttgctgacctctttgccgactatgccacattcgccttc
cagtcctttggggaccttgttgagatctggttcaccttcaatgacttggagaaagcaatc
ctggatctcccccaccaggattcgaaagcttctgctctccaaaccctcagcaatgcccac
aggaaagcctttgaagtgtatcacagaaagttctcttctcagggaggaaggctctctgtg
gtcctgaaggctgaagatattcctgagcttctgcgagccccatcctctgctgccctcacc
aaggagtcggttgatttcctctctcttgatttgacctttgagtgccaaagtgtggcgacc
ctaccacagaagctgagtgaactacagaacattgagcccaaaatgaaagttttcatctat
gcgctgaaatttcaggactgcccatccacagggatgagcccctcctcactgctcttcagc
ctgtttgaagctataaataaagaacaagtacagactgttgggttcgacatcaatgcattc
ctgagctgtccatccagttctgaggagagcccatcttgttctctaaccgagaggctggcc
ttgcagactgagacagcagctgtgccctcttcccctgtatcagcctaccagagggtctgg
gcagcttttgctaaccagtctagggcggaaagggatgccttcttgcaagatgtgttccca
gaagggttcctctggggcgtgtccacgggagcctttaatgtggaaggaggatgggccgag
gacagcagagggccaagcatctgggaccactacagtaacccgaatgttcccgagggccaa
gcgacggcaaaggtggccagtgacagttaccacaaaccagcctctgatgtcgccctgctc
cgaggcctcagggctggggtgtacaaattctccatctcctggtcccggctgttccccact
gggcagaagagcagccccaacctccaaggtgtcacctactacaaccgactgatagacagc
ctgctggactcccacattgagcccatggccacgctatttcactgggacctgcctcaggcc
ctgcaggatcaaggcgggtggcagaacgagagtgtggtggacgccttcctggactatgca
gccttctgcttctccacttttggggaccgtgtgaagctgtgggtgaccttccacgagcca
tgggtgataagctatgcaggctatggcactgggcagcatgcaccagccatctctgaccca
ggagtggcttcttttaaggtggctcacttgatcctcaaggcgcacgccagaacttggcat
cactatgaccttcaccaccgccaacagcagcagggacgcgtgggcattgtgctcaattca
gactgggcagaacccctggacagggagagtccccaggaccttgctgctgcggagcgattc
ctgcacttcatgctgggctggtttgcacaccccatctttgtggatggaaactaccccacc
acccttagggcccagatccagcacataaaccagcagtgtggtggtcctctggcccaactt
ccagagttcactgcagaggagaagcagctcctgaaaggctctgccgacttccttggcctg
tctcattacacatcacgcctcatcagcaaggctgggcagcagacctgcatccccagctat
gataacatcggaggcttctcccagcatgtagaccccacgtggccccagactgcatctccc
tggattcgggtagtgccctggggcataaggaggctgcttgggtttgcttccatggaatac
acgaaaggaagagttccaatcttcttggctgggaatggcatgccagtaggggagggagcg
gatttccttgatgactcagtgagagtgaactacttcaacctgtacatcaacgaagtgctc
aaggctgtcaaggaggatttggtggatgtccgttcatacattgctcgttccctcattgat
ggttttgaaggacccccaggttacagccagaggtttgggctgtaccatgtcaacttcagt
gacagcagcaggccgagaacggccaggaaatctgcctacttcttcaccaacatcattgaa
aagaatggctttcctgccgagagaataagaagaaacccactgcctatgagaactggcttt
acctccagagccacaaccgtcctcaacttcccatctgaggtaccctccaaggctaaaata
gtgtgggagaagttctccaaccagcccaagtttgaaagagacctgttctatcatggcaca
ttccgggatgacttcctgtggggtgtgtcctcttcagcctatcaaatcgagggaggttgg
gatgctgacggtaaaggccccagcatctgggacaacttcacccacactccggggaacaac
gtgaaagacaatgccacgggagacatagcatgtgacagctatcaccaactggatgccgac
ctaaacattcttcgtgccctgaaggtcaaggcctatcggttctctatctcctggtctcgg
attttcccaacaggaagaaatgattccatcaacactcctggtgttgactattacaacagg
ctgattgatggcttggtgaagagcaacatcttccccatggtgacactgtttcactgggac
ctgccccaggccctccaggatattggaggttgggaaaacccttctttgattgagttgttc
aacagctatgcagacttctgtttcaggacctttggtgacagagtcaagttctggatgacc
tttaacgagcccttgtatctggcactgttaggctatggttccggggtgtttcccccaaat
gttcaggacccaggctgggcaccttacagggtcagccatgtcgtcatcaaggctcatgct
agagtctaccatacttacgctgagaaatacaggcaggagcagagtggggtcatttcactg
agcctcaacactcactgggtggagcccaagaacccagggctccaaagagacgtggaagct
gctgaccggatgctgcaattttccctgggctggtttgcccaccccatttttagaaacgga
gactatccagatgccatgaaatggaatgtggggaacaggagtgagctgcagcacctggct
gagtcccgcctgcccagcttcacggaggaggagaaggcttacatcatgggtaccgctgat
gtcttctgcctcaacacctattcgtctgaatttgtgcagcatagcactcctaggctgaat
ccacccagctacgatgatgaccgggagctaacggtcagcagtatggactcttcattgatc
tccacgacaatgcatgcagccgtgccctgggggatgcggaggctgctgaactggatcaag
gaagagtatggtaacattcccatttacatcactgagaatggacaggggctagacaacccc
acgctggacgacacacaaaggatattctaccacaaaacctatatcaatgaggctctgaaa
gcctacagactggatggtgtggaccttcgagggtattctgcctggtctctgatggacaac
tttgagtggctgtcgggctacacagtcaagtttggactgtatcatgttgactttgaccaa
gtgaacaggcctcgaactgcaagagcctcagccagatactatacagaggtcattaccaac
aatggcatgcccctggccaaggaggatgagttcctgtatggagagttccccaagggcttc
atctggagtgcggcttctgctgcatatcagattgaaggtgcctggagagcagatggcaaa
ggactcagtatttgggacacattttcccacacgccactgaagattgagaataatgacaat
ggagatgtggcctgtgacagttaccataagattgccgaggatgtgatggcccttcagtac
ctgggtgtgtcccactaccgattctccatctcctggcctagagtcctcccagacggaacc
accaagttcatcaatgaagcaggactcaactactatgctcgattcatcgatgcactgctg
gctgctggcattacaccacaggtgaccatgtatcactgggacctgccccaggcactgcaa
gacatcgggggctgggagaacgagacaattgtgcagctatttagggagtacgcagatgtg
ctgttccagaagctgggggacaaggtgaagttttggatcacactgaatgagcccttcgtc
attgctgcccatggctatggcagtggagtgtctgctccaggaatctccttcaggcctggc
acggctccatacactgctggccacaacctaataaaggctcacgctgaggcttggcatctc
tacaatgacaagtaccgcgccagccagaaaggtgtgatttccatcacgatcagcagtgac
tgggctgaacccagggatccctccaagcaggaggacattgaggccgccaggagatatgtc
cagttcatgggaggctggtttgcacaccccatcttcagtaacggagattacccagaggtg
atgaagacacggattcttgagaggagcctggcagcaggcctcaacaagtcaaggctccct
gagtttacagagaatgagaagatgaggatcaagggtacttttgacttcttcgggttcaac
cactacaccactgtactggcctacaacctcaactatcctgctgccatctcttcttttgat
gcagacaggggagttgcctccattgcagacagctcttggccagactctggctccttctgg
ctgaaggtgaccccttttggcttccggaggatcttgaactggctgaaagaggaatacaaa
aaccctccaatttatgtcacagagaatggagtgtccagacggggagtcccagaactcaat
gacaccgacaggatctactacctccgcagctacatcaatgaggccctcaaagctgtgcag
gataaggtggaccttcgaggatacacgttatggagcgtgatggacaacttcgaatgggcc
acaggctttgcagagaggtttggtgtacactttgtgaaccgctctgacccttctctgcca
aggatccccaaggcatcggccaacttctacgcttctgtagtccgctgcaatggctttcct
gaccctgcacaaggacctcatccttgtctctaccaaccagaggaagctggacccactggc
agcccagtgaaggcagacgtgcccttcctggggctgatgctgggcaaaacagaagcacag
acggcgttgtatgtgctcttcgctcttctgctacttgcagtctgtagcttggcatttcta
ttctacaaatactgcaagcgctccaagcaacgggaaacacagccaaatcaccacaacctg
agtccaatttcctccttctga

DBGET integrated database retrieval system