KEGG   Cricetulus griseus (Chinese hamster): 100767097
Entry
100767097         CDS       T02813                                 

Gene name
Prkacb
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X2
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04014  Ras signaling pathway
cge04020  Calcium signaling pathway
cge04024  cAMP signaling pathway
cge04062  Chemokine signaling pathway
cge04114  Oocyte meiosis
cge04140  Autophagy - animal
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04261  Adrenergic signaling in cardiomyocytes
cge04270  Vascular smooth muscle contraction
cge04310  Wnt signaling pathway
cge04340  Hedgehog signaling pathway
cge04371  Apelin signaling pathway
cge04530  Tight junction
cge04540  Gap junction
cge04611  Platelet activation
cge04713  Circadian entrainment
cge04714  Thermogenesis
cge04720  Long-term potentiation
cge04723  Retrograde endocannabinoid signaling
cge04724  Glutamatergic synapse
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04727  GABAergic synapse
cge04728  Dopaminergic synapse
cge04740  Olfactory transduction
cge04742  Taste transduction
cge04750  Inflammatory mediator regulation of TRP channels
cge04910  Insulin signaling pathway
cge04911  Insulin secretion
cge04912  GnRH signaling pathway
cge04913  Ovarian steroidogenesis
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04918  Thyroid hormone synthesis
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04922  Glucagon signaling pathway
cge04923  Regulation of lipolysis in adipocytes
cge04924  Renin secretion
cge04925  Aldosterone synthesis and secretion
cge04926  Relaxin signaling pathway
cge04927  Cortisol synthesis and secretion
cge04928  Parathyroid hormone synthesis, secretion and action
cge04934  Cushing syndrome
cge04935  Growth hormone synthesis, secretion and action
cge04961  Endocrine and other factor-regulated calcium reabsorption
cge04962  Vasopressin-regulated water reabsorption
cge04970  Salivary secretion
cge04971  Gastric acid secretion
cge04976  Bile secretion
cge05012  Parkinson disease
cge05020  Prion disease
cge05030  Cocaine addiction
cge05031  Amphetamine addiction
cge05032  Morphine addiction
cge05034  Alcoholism
cge05146  Amoebiasis
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100767097 (Prkacb)
   04014 Ras signaling pathway
    100767097 (Prkacb)
   04310 Wnt signaling pathway
    100767097 (Prkacb)
   04340 Hedgehog signaling pathway
    100767097 (Prkacb)
   04371 Apelin signaling pathway
    100767097 (Prkacb)
   04020 Calcium signaling pathway
    100767097 (Prkacb)
   04024 cAMP signaling pathway
    100767097 (Prkacb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100767097 (Prkacb)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100767097 (Prkacb)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100767097 (Prkacb)
   04540 Gap junction
    100767097 (Prkacb)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100767097 (Prkacb)
   04062 Chemokine signaling pathway
    100767097 (Prkacb)
  09152 Endocrine system
   04911 Insulin secretion
    100767097 (Prkacb)
   04910 Insulin signaling pathway
    100767097 (Prkacb)
   04922 Glucagon signaling pathway
    100767097 (Prkacb)
   04923 Regulation of lipolysis in adipocytes
    100767097 (Prkacb)
   04912 GnRH signaling pathway
    100767097 (Prkacb)
   04913 Ovarian steroidogenesis
    100767097 (Prkacb)
   04915 Estrogen signaling pathway
    100767097 (Prkacb)
   04914 Progesterone-mediated oocyte maturation
    100767097 (Prkacb)
   04921 Oxytocin signaling pathway
    100767097 (Prkacb)
   04926 Relaxin signaling pathway
    100767097 (Prkacb)
   04935 Growth hormone synthesis, secretion and action
    100767097 (Prkacb)
   04918 Thyroid hormone synthesis
    100767097 (Prkacb)
   04919 Thyroid hormone signaling pathway
    100767097 (Prkacb)
   04928 Parathyroid hormone synthesis, secretion and action
    100767097 (Prkacb)
   04916 Melanogenesis
    100767097 (Prkacb)
   04924 Renin secretion
    100767097 (Prkacb)
   04925 Aldosterone synthesis and secretion
    100767097 (Prkacb)
   04927 Cortisol synthesis and secretion
    100767097 (Prkacb)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100767097 (Prkacb)
   04270 Vascular smooth muscle contraction
    100767097 (Prkacb)
  09154 Digestive system
   04970 Salivary secretion
    100767097 (Prkacb)
   04971 Gastric acid secretion
    100767097 (Prkacb)
   04976 Bile secretion
    100767097 (Prkacb)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100767097 (Prkacb)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100767097 (Prkacb)
  09156 Nervous system
   04724 Glutamatergic synapse
    100767097 (Prkacb)
   04727 GABAergic synapse
    100767097 (Prkacb)
   04725 Cholinergic synapse
    100767097 (Prkacb)
   04728 Dopaminergic synapse
    100767097 (Prkacb)
   04726 Serotonergic synapse
    100767097 (Prkacb)
   04720 Long-term potentiation
    100767097 (Prkacb)
   04723 Retrograde endocannabinoid signaling
    100767097 (Prkacb)
  09157 Sensory system
   04740 Olfactory transduction
    100767097 (Prkacb)
   04742 Taste transduction
    100767097 (Prkacb)
   04750 Inflammatory mediator regulation of TRP channels
    100767097 (Prkacb)
  09149 Aging
   04211 Longevity regulating pathway
    100767097 (Prkacb)
   04213 Longevity regulating pathway - multiple species
    100767097 (Prkacb)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100767097 (Prkacb)
   04714 Thermogenesis
    100767097 (Prkacb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100767097 (Prkacb)
   05205 Proteoglycans in cancer
    100767097 (Prkacb)
   05203 Viral carcinogenesis
    100767097 (Prkacb)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100767097 (Prkacb)
   05020 Prion disease
    100767097 (Prkacb)
  09165 Substance dependence
   05030 Cocaine addiction
    100767097 (Prkacb)
   05031 Amphetamine addiction
    100767097 (Prkacb)
   05032 Morphine addiction
    100767097 (Prkacb)
   05034 Alcoholism
    100767097 (Prkacb)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100767097 (Prkacb)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100767097 (Prkacb)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100767097 (Prkacb)
   05163 Human cytomegalovirus infection
    100767097 (Prkacb)
   05165 Human papillomavirus infection
    100767097 (Prkacb)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100767097 (Prkacb)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100767097 (Prkacb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cge01001]
    100767097 (Prkacb)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cge03019]
    100767097 (Prkacb)
   03036 Chromosome and associated proteins [BR:cge03036]
    100767097 (Prkacb)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100767097 (Prkacb)
Protein kinases [BR:cge01001]
 Serine/threonine kinases: AGC group
  PKA family
   100767097 (Prkacb)
Messenger RNA biogenesis [BR:cge03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100767097 (Prkacb)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100767097 (Prkacb)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 100767097
NCBI-ProteinID: XP_035306559
LinkDB
Position
1
AA seq 596 aa
MGDRRDHGVRTREGGEGPGVRGEQRAEAPVTAGSGERALAADAGSAGRRGARAASPTAPT
ARPRVRAARACGTRAARKQEQAEPRHCAPRRALGHRMPRRGSPRATAAENRGVAAPARLR
GAATRRGGGLRRRHFRRALPPARSRSRSGPEVALGASGWRPGRARSRGRAGGGLGKGECL
RAAAAAAAVPVARCPELAASLRPAHPTGASAARAGAAADCGAAPAPAPSVPGLPCLRHPC
SPPPGHGNTAIAKKGSEVESVKEFLAKAKEDFLRKWENPPPSNAGLEDFERKKTLGTGSF
GRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVEFPFLVRLEYSFKDNS
NLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLI
DHQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAG
YPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTH
KWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEEIRVSITEKCGKEFCEF
NT seq 1791 nt   +upstreamnt  +downstreamnt
atgggagaccggcgggaccacggagtgcgaactcgggaaggaggtgagggacccggtgtg
cggggagagcaaagggcagaagctccagtgacggctgggagcggagagcgggcactggcg
gctgacgccgggtccgcagggcgcagaggggcgcgtgcagcttcccccaccgccccgacg
gctcgccctcgggtgagagcggcccgcgcgtgcggaacccgggccgcccggaagcaggag
caggccgagccccggcactgtgccccccgccgggctctagggcaccggatgccacgccga
ggaagccctcgcgcaaccgcggcggagaaccgcggggtcgccgctccagcccggctcaga
ggggctgccacccgccggggggggggcttgcgcagacgtcacttccggcgcgccctcccg
cccgcccgctcgcggagccgctccgggcccgaggtcgcgctcggggcgagcggctggcgg
ccagggcgcgcgcggagccgggggcgcgcgggaggcgggctcgggaagggggagtgtctg
cgcgccgccgccgccgccgccgcggtccccgtcgctcgctgcccggagctcgccgcatct
ctccgccccgcgcacccgaccggcgcgagcgcagcgcgagcgggagctgcggcggactgc
ggggcggccccagccccggccccctccgtccccggcctgccctgcctccggcacccctgc
tcgccgcctccgggccatgggaacactgcgatcgccaagaaaggcagcgaggtggagagc
gtgaaagaatttctagccaaagccaaagaagactttctgaggaaatgggagaaccctccc
ccgagtaatgctgggcttgaagattttgaaaggaaaaaaacccttggaacgggttctttc
gggagagtcatgctggtgaagcataaagccactgagcagtactatgccatgaagatctta
gacaagcagaaggtggttaagctgaagcaaatagaacatactttgaatgagaaaagaata
ctacaggcggtggagtttccgtttcttgtccgactggagtattcttttaaggataattct
aatttatacatggttatggaatatgttcctgggggtgaaatgttttctcatctgagaaga
attggaaggttcagtgagccacatgctcgattctacgcggctcagattgtgctcacgttt
gagtacctccactccctggacctcatctacagagatctcaagcctgagaacctcttaatt
gaccaccagggttacatccaggtcacagacttcgggtttgccaagagagtgaagggcagg
acctggacactgtgtggcaccccagagtacctggcccctgagatcatcctcagcaagggc
tacaataaggcagtggactggtgggcactgggagtgctcatctatgagatggccgctggc
taccccccattctttgcagaccagcctattcagatttatgagaagatcgtttctggaaag
gtccggttcccctcccacttcagctctgacctcaaggacctcctacggaacctgctgcag
gtggatctgaccaagcgattcggaaacctgaagaatggcgtgagtgacataaagacccac
aagtggtttgccacgactgactggattgctatttaccagagaaaggttgaggctccattc
ataccaaagttcagaggctctggggataccagcaacttcgatgactatgaagaagaagaa
atccgtgtctctataacagaaaaatgtggaaaagaattttgtgaattttag

KEGG   Cricetulus griseus (Chinese hamster): 100768997
Entry
100768997         CDS       T02813                                 

Gene name
Prkaca
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha isoform X2
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04014  Ras signaling pathway
cge04020  Calcium signaling pathway
cge04024  cAMP signaling pathway
cge04062  Chemokine signaling pathway
cge04114  Oocyte meiosis
cge04140  Autophagy - animal
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04261  Adrenergic signaling in cardiomyocytes
cge04270  Vascular smooth muscle contraction
cge04310  Wnt signaling pathway
cge04340  Hedgehog signaling pathway
cge04371  Apelin signaling pathway
cge04530  Tight junction
cge04540  Gap junction
cge04611  Platelet activation
cge04713  Circadian entrainment
cge04714  Thermogenesis
cge04720  Long-term potentiation
cge04723  Retrograde endocannabinoid signaling
cge04724  Glutamatergic synapse
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04727  GABAergic synapse
cge04728  Dopaminergic synapse
cge04740  Olfactory transduction
cge04742  Taste transduction
cge04750  Inflammatory mediator regulation of TRP channels
cge04910  Insulin signaling pathway
cge04911  Insulin secretion
cge04912  GnRH signaling pathway
cge04913  Ovarian steroidogenesis
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04918  Thyroid hormone synthesis
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04922  Glucagon signaling pathway
cge04923  Regulation of lipolysis in adipocytes
cge04924  Renin secretion
cge04925  Aldosterone synthesis and secretion
cge04926  Relaxin signaling pathway
cge04927  Cortisol synthesis and secretion
cge04928  Parathyroid hormone synthesis, secretion and action
cge04934  Cushing syndrome
cge04935  Growth hormone synthesis, secretion and action
cge04961  Endocrine and other factor-regulated calcium reabsorption
cge04962  Vasopressin-regulated water reabsorption
cge04970  Salivary secretion
cge04971  Gastric acid secretion
cge04976  Bile secretion
cge05012  Parkinson disease
cge05020  Prion disease
cge05030  Cocaine addiction
cge05031  Amphetamine addiction
cge05032  Morphine addiction
cge05034  Alcoholism
cge05146  Amoebiasis
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100768997 (Prkaca)
   04014 Ras signaling pathway
    100768997 (Prkaca)
   04310 Wnt signaling pathway
    100768997 (Prkaca)
   04340 Hedgehog signaling pathway
    100768997 (Prkaca)
   04371 Apelin signaling pathway
    100768997 (Prkaca)
   04020 Calcium signaling pathway
    100768997 (Prkaca)
   04024 cAMP signaling pathway
    100768997 (Prkaca)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100768997 (Prkaca)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100768997 (Prkaca)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100768997 (Prkaca)
   04540 Gap junction
    100768997 (Prkaca)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100768997 (Prkaca)
   04062 Chemokine signaling pathway
    100768997 (Prkaca)
  09152 Endocrine system
   04911 Insulin secretion
    100768997 (Prkaca)
   04910 Insulin signaling pathway
    100768997 (Prkaca)
   04922 Glucagon signaling pathway
    100768997 (Prkaca)
   04923 Regulation of lipolysis in adipocytes
    100768997 (Prkaca)
   04912 GnRH signaling pathway
    100768997 (Prkaca)
   04913 Ovarian steroidogenesis
    100768997 (Prkaca)
   04915 Estrogen signaling pathway
    100768997 (Prkaca)
   04914 Progesterone-mediated oocyte maturation
    100768997 (Prkaca)
   04921 Oxytocin signaling pathway
    100768997 (Prkaca)
   04926 Relaxin signaling pathway
    100768997 (Prkaca)
   04935 Growth hormone synthesis, secretion and action
    100768997 (Prkaca)
   04918 Thyroid hormone synthesis
    100768997 (Prkaca)
   04919 Thyroid hormone signaling pathway
    100768997 (Prkaca)
   04928 Parathyroid hormone synthesis, secretion and action
    100768997 (Prkaca)
   04916 Melanogenesis
    100768997 (Prkaca)
   04924 Renin secretion
    100768997 (Prkaca)
   04925 Aldosterone synthesis and secretion
    100768997 (Prkaca)
   04927 Cortisol synthesis and secretion
    100768997 (Prkaca)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100768997 (Prkaca)
   04270 Vascular smooth muscle contraction
    100768997 (Prkaca)
  09154 Digestive system
   04970 Salivary secretion
    100768997 (Prkaca)
   04971 Gastric acid secretion
    100768997 (Prkaca)
   04976 Bile secretion
    100768997 (Prkaca)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100768997 (Prkaca)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100768997 (Prkaca)
  09156 Nervous system
   04724 Glutamatergic synapse
    100768997 (Prkaca)
   04727 GABAergic synapse
    100768997 (Prkaca)
   04725 Cholinergic synapse
    100768997 (Prkaca)
   04728 Dopaminergic synapse
    100768997 (Prkaca)
   04726 Serotonergic synapse
    100768997 (Prkaca)
   04720 Long-term potentiation
    100768997 (Prkaca)
   04723 Retrograde endocannabinoid signaling
    100768997 (Prkaca)
  09157 Sensory system
   04740 Olfactory transduction
    100768997 (Prkaca)
   04742 Taste transduction
    100768997 (Prkaca)
   04750 Inflammatory mediator regulation of TRP channels
    100768997 (Prkaca)
  09149 Aging
   04211 Longevity regulating pathway
    100768997 (Prkaca)
   04213 Longevity regulating pathway - multiple species
    100768997 (Prkaca)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100768997 (Prkaca)
   04714 Thermogenesis
    100768997 (Prkaca)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100768997 (Prkaca)
   05205 Proteoglycans in cancer
    100768997 (Prkaca)
   05203 Viral carcinogenesis
    100768997 (Prkaca)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100768997 (Prkaca)
   05020 Prion disease
    100768997 (Prkaca)
  09165 Substance dependence
   05030 Cocaine addiction
    100768997 (Prkaca)
   05031 Amphetamine addiction
    100768997 (Prkaca)
   05032 Morphine addiction
    100768997 (Prkaca)
   05034 Alcoholism
    100768997 (Prkaca)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100768997 (Prkaca)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100768997 (Prkaca)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100768997 (Prkaca)
   05163 Human cytomegalovirus infection
    100768997 (Prkaca)
   05165 Human papillomavirus infection
    100768997 (Prkaca)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100768997 (Prkaca)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100768997 (Prkaca)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cge01001]
    100768997 (Prkaca)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cge03019]
    100768997 (Prkaca)
   03036 Chromosome and associated proteins [BR:cge03036]
    100768997 (Prkaca)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100768997 (Prkaca)
Protein kinases [BR:cge01001]
 Serine/threonine kinases: AGC group
  PKA family
   100768997 (Prkaca)
Messenger RNA biogenesis [BR:cge03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100768997 (Prkaca)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100768997 (Prkaca)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 100768997
NCBI-ProteinID: XP_027261982
LinkDB
Structure
PDB: 

Position
3
AA seq 351 aa
MGNAAAAKKGSEQESVKEFLAKAKEEFLKKWESPSQNTAQLDHFDRIKTLGTGSFGRVML
VKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFTEF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgggcaacgccgccgccgccaagaagggcagcgagcaggagagcgtgaaagagttccta
gccaaggccaaggaagaattcctgaaaaaatgggagagcccttctcagaatacagcccag
ttggatcactttgatagaatcaagacacttggcactggctcctttgggcgagtgatgctc
gtgaagcacaaggagactgggaaccactatgccatgaagatcttggacaaacagaaggtg
gtgaagctgaagcagattgagcacactctaaatgagaagcgcatcctgcaggctgtcaac
ttcccgttcctggtcaaacttgaattctccttcaaggacaactcaaacttgtacatggtc
atggagtatgtgcctggtggggagatgttctcccacttgcggcggatcggaaggttcagc
gagccccatgcccgtttctacgcggcgcagatcgtcctgacctttgagtatctgcactcc
ctggacctcatctaccgggacctgaagcccgagaaccttctcatcgaccagcagggctat
attcaggtgacagacttcggttttgccaagcgtgtgaaaggccggacttggaccttgtgt
gggacccctgagtacttggcccccgagattatcctgagcaaaggctacaacaaggctgtg
gactggtgggctctcggagtcctcatctacgagatggctgctggttacccacccttcttc
gctgaccagcctatccagatctacgagaaaatcgtctctgggaaggtgcggttcccatct
cacttcagctctgacttgaaggacctgctacggaaccttctgcaggtggatctcaccaag
cgctttgggaacctcaagaacggggtcaatgacatcaagaaccataagtggtttgccacg
actgactggattgccatctatcagagaaaggtggaagctcccttcataccaaagtttaaa
ggccctggggacacgagtaactttgacgactatgaggaggaagagatccgggtctccatc
aatgagaagtgtggcaaggagtttactgagttttag

DBGET integrated database retrieval system