KEGG   Cricetulus griseus (Chinese hamster): 100767112
Entry
100767112         CDS       T02813                                 

Gene name
Atf6b
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X2
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04022  cGMP-PKG signaling pathway
cge04141  Protein processing in endoplasmic reticulum
cge04151  PI3K-Akt signaling pathway
cge04211  Longevity regulating pathway
cge04261  Adrenergic signaling in cardiomyocytes
cge04668  TNF signaling pathway
cge04728  Dopaminergic synapse
cge04911  Insulin secretion
cge04915  Estrogen signaling pathway
cge04918  Thyroid hormone synthesis
cge04925  Aldosterone synthesis and secretion
cge04926  Relaxin signaling pathway
cge04927  Cortisol synthesis and secretion
cge04928  Parathyroid hormone synthesis, secretion and action
cge04934  Cushing syndrome
cge04935  Growth hormone synthesis, secretion and action
cge05020  Prion disease
cge05030  Cocaine addiction
cge05031  Amphetamine addiction
cge05034  Alcoholism
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100767112 (Atf6b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100767112 (Atf6b)
   04022 cGMP-PKG signaling pathway
    100767112 (Atf6b)
   04151 PI3K-Akt signaling pathway
    100767112 (Atf6b)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100767112 (Atf6b)
   04915 Estrogen signaling pathway
    100767112 (Atf6b)
   04926 Relaxin signaling pathway
    100767112 (Atf6b)
   04935 Growth hormone synthesis, secretion and action
    100767112 (Atf6b)
   04918 Thyroid hormone synthesis
    100767112 (Atf6b)
   04928 Parathyroid hormone synthesis, secretion and action
    100767112 (Atf6b)
   04925 Aldosterone synthesis and secretion
    100767112 (Atf6b)
   04927 Cortisol synthesis and secretion
    100767112 (Atf6b)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100767112 (Atf6b)
  09156 Nervous system
   04728 Dopaminergic synapse
    100767112 (Atf6b)
  09149 Aging
   04211 Longevity regulating pathway
    100767112 (Atf6b)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100767112 (Atf6b)
  09164 Neurodegenerative disease
   05020 Prion disease
    100767112 (Atf6b)
  09165 Substance dependence
   05030 Cocaine addiction
    100767112 (Atf6b)
   05031 Amphetamine addiction
    100767112 (Atf6b)
   05034 Alcoholism
    100767112 (Atf6b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100767112 (Atf6b)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100767112 (Atf6b)
   05161 Hepatitis B
    100767112 (Atf6b)
   05163 Human cytomegalovirus infection
    100767112 (Atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cge03000]
    100767112 (Atf6b)
Transcription factors [BR:cge03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100767112 (Atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 GIT_CC ZapB bZIP_Maf YabA Docking
Other DBs
NCBI-GeneID: 100767112
NCBI-ProteinID: XP_027244577
LinkDB
Position
1
AA seq 707 aa
MVGGGGKMAELMLLSEIADPTRFFTDNLLSPEDWDSTLYSGLDEVAEEQAPLFRCVEQDV
PFDSNPLDVGMDVSPPEPPWDPLPIFPDLQVKSEPSSPCSSSSLSSESSHLSAEPSSQVP
GVGEVLSVKMESLAPPLCLLGDDPASPFETVQITVGSVADDPSDIQTKVEPASPSSSVNS
EASLLSADSPSQAFIGEEVLEVKTESPSPPGCLLWDVPAPSLGAVQISMGPSPVSSSGKA
PATRKPPLQPKPVVLTTVQVPPRAGPPSTTVLLQPLVQQPAVSPVVLIQGAIRVQPEGPA
PAVPRPERKSIVPAPLPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEAR
LQAVLADNQQLRRENAALRRRLETLLTENSELKLGSGNRKVVCIMVFLLFIAFNFGPVSI
SEPPPAPISPRMSREEARPRRHLLEFSEQGPAHGVEPLQKAARGPEERQPSPAGRPSFRN
LTAFPGGAKELLLRDLDQLFLASDCRHFNRTESLRLADELSGWVQRHQRGRRRMPHRAQE
RQKSQLRKKSPPVKPVPTQPPGPPERDPVGQLQLYRHPGRSQPEFLDAIDRREDTFYVVS
FRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETVSGRGPPGDYEEMMQIECEVMDTRVIH
IKTSTVPPSLRKQPSPTPGNTTGGPLPASAASQASQASHQPLYLNHP
NT seq 2124 nt   +upstreamnt  +downstreamnt
atggtggggggtggggggaagatggcggagctgatgctcctgagcgagatcgccgacccg
acgcgcttcttcaccgacaacctgctgagcccggaggactgggacagcaccctgtacagc
ggcctggatgaagtggccgaggagcaggcgccgctgttccgctgcgtggagcaggatgtc
ccgtttgacagcaaccctctggatgtggggatggatgtcagcccccctgagcccccctgg
gaccctctacctatcttcccagatcttcaggtgaagtctgagccgtcctctccatgctct
tcctcctccctgagctcagagtcatcgcatctttctgcagagccctccagccaggttcct
ggagtaggggaggtcctcagtgtgaagatggagtccttagcacctccactctgcctgctg
ggagacgatccagcatccccatttgaaacggtccaaatcaccgtgggttctgtcgctgat
gacccctcagatatccagaccaaggtagaacccgcctctccatcttcttctgtcaactcc
gaggcctccctgctctcagcagactctcccagccaggcttttataggagaggaggttctg
gaagtgaagacggagtccccatctcctccggggtgcctcctgtgggatgtcccagctcct
tcacttggagctgtccagatcagcatgggcccatcacctgttagttcctcagggaaagct
ccagccactcggaagcctccactgcagcccaagcctgtggtgctaaccacagttcaggtg
ccacctagagctgggcctcccagcactactgtccttttgcagcccctcgtccagcagccc
gcagtgtccccagttgtcctcatccaaggtgctattcgagtccagcctgaagggccagcc
cctgcagttccacggcccgaaaggaagagcattgtccctgctcctctgcctgggaactcc
tgccctcctgaagtggacgcaaagctgctgaagcgtcagcagcgaatgatcaagaacaga
gagtcggcctgccagtcccgccggaagaagaaagagtatctgcagggactggaggccaga
ctgcaggctgtgctggcagacaaccagcaactgcgcagggagaatgctgccctccggcgg
cggctggagaccctgctgacagagaacagtgagctcaagctgggctctgggaacaggaaa
gttgtctgcatcatggtcttccttctcttcattgccttcaactttggacctgtgagcatt
agtgagccacctccagctcccatctctcctcggatgagcagggaggaagctcgacccagg
agacacctgctggagttctccgagcaggggccagctcatggtgttgaacccctccagaaa
gctgcccggggcccagaggagcggcagcccagccctgcaggcaggcccagcttcagaaac
ctgacagccttccctggcggggccaaggagctgctgctgagagacctggaccagctcttc
ctcgcctctgactgccgccacttcaaccgcacggagtccctgaggcttgctgatgagctg
agtggctgggtgcagcgtcaccagagaggtcgacggaggatgcctcacagggcccaggag
agacagaagtctcagctacggaagaagtcaccgccagtgaaaccagtccccacccaacct
ccaggacctcctgagagggaccctgtggggcagctgcagctctaccgccacccaggccgt
tcgcagcctgagtttctagatgcaatcgaccggcgggaagacaccttctatgttgtctcc
ttccgaagggaccacttgctgctcccggccatcagccacaacaagacgtccagacccaag
atgtccctggtgatgccagccatggcccccaatgagaccgtgtcaggccgggggccccca
ggggactatgaggagatgatgcagatcgagtgtgaggtcatggacaccagggtgattcac
atcaagacctccacggtgcccccctcactccggaagcagccatccccaaccccaggcaat
accacaggtggccccctgccagcttctgcagccagtcaggccagtcaggcctcccaccag
cccctctacctcaaccacccctga

DBGET integrated database retrieval system