KEGG   Cricetulus griseus (Chinese hamster): 100767365Help
Entry
100767365         CDS       T02813                                 

Gene name
Lig1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge03030  DNA replication
cge03410  Base excision repair
cge03420  Nucleotide excision repair
cge03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cge00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100767365 (Lig1)
   03410 Base excision repair
    100767365 (Lig1)
   03420 Nucleotide excision repair
    100767365 (Lig1)
   03430 Mismatch repair
    100767365 (Lig1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cge03032]
    100767365 (Lig1)
   03400 DNA repair and recombination proteins [BR:cge03400]
    100767365 (Lig1)
Enzymes [BR:cge01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100767365 (Lig1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     100767365 (Lig1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     100767365 (Lig1)
DNA replication proteins [BR:cge03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    100767365 (Lig1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     100767365 (Lig1)
DNA repair and recombination proteins [BR:cge03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     100767365 (Lig1)
   NER (nucleotide excision repair)
    Other NER factors
     100767365 (Lig1)
   MMR (mismatch exicision repair)
    Other MMR factors
     100767365 (Lig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DDR
Motif
Other DBs
NCBI-GeneID: 100767365
NCBI-ProteinID: XP_007620988
LinkDB All DBs
Position
5
AA seq 931 aa AA seqDB search
MRKKEPERKGENSAATMQKSIRSFFQPMKEGKAQKPEKETANSTKEKEPPPKVALKERNR
AVPESDSPVKRPGRKAAQVLSSEGEEEDEAPSTPKVQKSVSDSKQSSPPSPDACPENSPF
HSSPSMEISPSGFPKRRTARKQLPKRTIEDTVEEQNEDKGRAAKKRKKEEEAQTPMESLT
ESEDVKPKEEKEEGKHAEASKSPESGTLTKTETIPVCKAGVKQKPQEEEQSKPPARGAKT
LSSFFTPRKPAEKAIVKQEEPGTPGKEETKGALDPTNYNPSKRNYHPIEDACWKHGQKVP
FLAVARTFEKIEEVSARLKMVETLSNLLRSVVALSPPDLLPVLYLSLNRLGPPQQGLELG
VGDGVLLKAVAQATGRQLESIRAEVAEKGDVGLVAENSRSTQRLMLPPPPLTTSGVFTKF
CDIARLTGSASMAKKLDAIKGLFVACRHSEARFIARSLSGRLRLGLAEQSVLAALALAVS
LTPPGQEFPPAVVDAGKGKTTEARKTWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLERL
PEHCRLSPGVPLKPMLAHPTRGVSEVLKRFEEVDFTCEYKYDGQRAQIHVLEGGEVKIFS
RNQEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDA
SEIQVQVCLYAFDLIYLNGESLIRQPLSRRRQLLRENFVETEGEFVFATSLDTKDIEQIA
EFLEQSVKDSCEGLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGR
GKRAGRYGGFLLAAYDEESEELQAICKLGTGFSDEELEEHHQSLKALVLPTPRPYVRIDG
AVAPDHWLDPKVVWEVKCADLSLSPIYPAARGLVDKEKGISLRFPRFIRVREDKQPEQAT
TSDQVACLYRKQSQIQNQHNSDLDSDFEDCY
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaagaaccagagaggaaaggggagaactctgctgccaccatgcagaaaagt
atcaggtcatttttccaacccatgaaagagggtaaagcacagaagccggagaaggagaca
gctaacagcaccaaagagaaggagccacctccaaaggtggcactgaaggagaggaatcga
gcagtgcctgagagtgattctccagtgaagaggcctggaaggaaggcagcccaggtccta
agcagcgaaggggaggaggaagatgaagcccccagcacccctaaagtccagaagtctgtg
tcagactccaaacaaagctctcctcccagccctgacgcatgtcctgagaacagtcctttc
cacagtagcccctccatggagatctccccatcaggattcccgaagcgtcgcactgctcgg
aagcagctcccgaaacggacaattgaggacactgtggaggagcagaatgaggacaaaggc
agagcagccaagaaaaggaagaaggaagaagaagcacagactccaatggaaagcctcaca
gagagtgaagatgtaaaacccaaggaagaaaaggaggagggcaagcatgctgaggcttcc
aagtcccctgagtcgggaaccttgacaaagacagagaccatcccagtgtgtaaggccggc
gtgaaacagaagcctcaggaagaggagcagagcaagcctcctgccagaggcgccaagaca
ctcagcagcttcttcactccccggaagccagcagagaaagccatagtgaaacaagaagag
ccaggtactccagggaaggaagagaccaagggagccctggatccaacaaattacaatcct
tccaagagaaactaccaccccattgaagatgcctgctggaaacatggccagaaagtccct
tttctcgctgtggcccggacctttgagaagattgaggaggtttctgctcggctcaagatg
gtggagacactgagcaacttgctgcgctcggtggtggccctgtcacctccagacctgctt
cccgttctttacctcagcctcaaccgccttgggccacctcagcagggactagagctgggt
gttggtgatggcgtcctccttaaggcagttgcccaggccacaggccgtcagctggagtcc
atccgggctgaggtggctgagaagggtgacgtgggactggtggccgagaacagccgcagc
actcagagactcatgctgccccctcctccgctcaccacctccggggtctttaccaaattc
tgtgacattgcccggctcactggcagtgcttccatggccaagaagttggatgccatcaag
ggcctgtttgttgcctgccgtcactcggaagcccggttcattgccaggtccctaagtgga
cgcctgcgcctcgggctggctgagcagtccgtcttggctgcccttgccctggctgtgagc
ctcacaccccctggccaagaatttcccccagctgttgtggatgctgggaagggcaagacc
acagaggccagaaagacatggttggaagaacaaggcatgatcttgaagcagaccttctgt
gaggtacctgacctggaccgaatcatcccggtgctgctggaacatggcctggaacgcctc
ccagagcactgcaggctgagcccaggggtccctcttaaaccaatgctggctcatcccact
cggggtgtcagcgaggtactgaaacgctttgaggaggtggactttacctgcgagtacaaa
tatgacgggcagcgggcccagattcatgttctggaaggtggagaggtgaagatcttcagt
aggaaccaggaagacaacacaggaaagtacccggacatcatcagccgcatccccaagatt
aaactcccctcggtcacgtcctttatcctggacactgaggctgtggcctgggaccgggaa
aagaagcagatccagccattccaagtgctcaccacacgcaagcgcaaggaggttgacgcc
tcggagatacaggtgcaggtgtgtctgtatgcctttgatctcatctacctcaatggagag
tccctgattcgccagcccctgtctcgacgtcggcagctgctccgggagaactttgtggag
acagagggtgagtttgtcttcgccacctccctggacaccaaggacatcgagcagatcgct
gagttcttggagcagtcggtgaaggactcctgtgagggactgatggtgaagaccctggat
gttgatgccacctatgagatcgccaagaggtctcacaactggctcaagctaaagaaggac
taccttgacggtgtgggcgacactctggaccttgtggtgattggcgcctacctgggccgg
gggaagcgtgccggccggtatgggggcttcctcttggctgcctatgatgaggagagtgaa
gagctgcaggccatatgcaagctgggaactggattcagtgatgaagagctggaggagcat
caccagagcctaaaggccctagtgttgccgaccccacgcccctatgtgaggatcgatggg
gcagttgccccagaccactggctggacccaaaggtcgtatgggaggtgaagtgtgcggat
ctctccctgtcccctatctaccctgctgcgcggggcctggtggacaaagagaaagggatc
tcccttcgtttccctcggttcattcgtgtccgtgaagacaagcagccagagcaggccacc
accagtgaccaggtggcctgtttgtaccggaagcagagtcagatacagaaccagcacaac
tcagacttggactccgactttgaggactgctattaa

DBGET integrated database retrieval system