KEGG   Cricetulus griseus (Chinese hamster): 100767446Help
Entry
100767446         CDS       T02813                                 

Gene name
Glb1
Definition
(RefSeq) beta-galactosidase isoform X3
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00052  Galactose metabolism
cge00511  Other glycan degradation
cge00531  Glycosaminoglycan degradation
cge00600  Sphingolipid metabolism
cge00604  Glycosphingolipid biosynthesis - ganglio series
cge01100  Metabolic pathways
cge04142  Lysosome
Module
cge_M00079  Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100767446 (Glb1)
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    100767446 (Glb1)
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100767446 (Glb1)
   00604 Glycosphingolipid biosynthesis - ganglio series
    100767446 (Glb1)
   00511 Other glycan degradation
    100767446 (Glb1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100767446 (Glb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100767446 (Glb1)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     100767446 (Glb1)
Exosome [BR:cge04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100767446 (Glb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5 DUF2164
Motif
Other DBs
NCBI-GeneID: 100767446
NCBI-ProteinID: XP_027271096
LinkDB All DBs
Position
4
AA seq 686 aa AA seqDB search
MREVIRQPPLWRHVAGRGWVCAQSAEPRGGTGRGGMGRGGSTRGGSRLRVLSPPEEERLA
RAPATEWRGPTRSASCSGSRCARCSCCRRRCCWAPRTASMYVPWNFHEPQPGQYEFSGDR
DVEYFIHLAHKLGLLVILRPGPYICAEWDMGGLPAWLLEKESIVLRSSDPDYLAAVDKWL
TVLLPKMKPLLYQNGGPIITVQVENEYGSYFACDYDYLRFLAHRFRYHLGNDVLLFTTDG
ANENFLRCGTLQGLYATVDFGAVKNITQAFLIQRKFEPKGPLINSEFYTGWLDHWGEPHY
TVKTEIVAASLYDLLARGASVNLYMFIGGTNFAYWNGANIPYAAQPTSYDYDAPLSEAGD
LTEKYFALRNVIQKFKDVPKGPIPPSTPKFAYGKVALRKFKTVAEALDVLCPNGPVRSRY
PLTFIQVKQYFGYVLYRTTLPQECNGSMPIFSSPFNGVRDRAYVAVDGVPQGILERNRVI
SLDIQGKAGAVLDILVENMGRVNYGRGINDFKGLISNMTLNFSILTNWTIFPLDTEAAVR
THLGAWEARDEGHHDGRLTFGSSNFTLPTFYVGNFSIPSGIPDLPQDTFIQFPGWTKGQV
WINGFNLGRYWPARGPQVTLFVPRHILTTSAPNNITVLELERSPCSDGTSELCTVEFVDR
PIIGRSLAISGPFPDRSGQDWWLNPL
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgcgggaagtgattagacaaccgccgctctggcgtcacgtagccgggagaggctgggtc
tgcgctcagagcgcagagccgcggggcgggactgggcggggcggaatggggcggggcggg
tccacccggggcgggtccaggctgagggtcctcagccccccggaggaggagcggctggcc
agagcgcccgcgaccgagtggcgcggtcccacccgatcggcgtcatgctccgggtcccgc
tgtgcacgctgctcctgctgtcggcgccgctgctgctgggcgccgcgcacggcttccatg
tacgtgccctggaactttcatgaaccccagccaggacaatatgagttttctggggaccgt
gacgtggaatatttcattcacctggctcacaagctggggctcctggtgatcctgaggcca
ggaccctacatctgtgcagagtgggacatgggagggttacctgcttggctgctagagaaa
gaatctattgttcttcgatcttctgacccagactaccttgcagctgtggataaatggctg
acagtccttctgcccaagatgaagcctctgctctaccagaatggagggccgattataact
gtgcaggttgagaatgagtacggctcctactttgcctgtgattatgactacctgcgtttc
ctggcacaccgcttccgttaccatctgggcaatgacgtccttctcttcaccaccgatggg
gcgaatgaaaacttccttcggtgtggcaccctgcagggcctctatgccacagtggatttt
ggagcagtcaagaatatcacacaggctttcctaatccagaggaaattcgaacccaaagga
cctttgatcaattctgagttctatactggctggctagaccactggggtgaaccccattac
acagtgaagactgaaatagtggctgcctctctctatgacctgcttgcccgtggggccagt
gtgaacttgtacatgtttataggtgggaccaattttgcctattggaatggtgccaacatt
ccctatgcagcacagcccaccagctatgactacgacgccccgctgagtgaggcaggggac
ctgactgagaagtattttgctcttcgaaatgtcatccagaagtttaaagatgtcccaaaa
ggtcctatccctccatcaactcccaagttcgcctatggaaaagttgctctgagaaagttc
aagacagtggcagaagctctggacgtcctgtgtcccaatggccccgtgagaagccgctac
ccgctgacattcatccaagttaaacagtattttgggtatgtgctgtaccgaacaacactt
cctcaagaatgcaatggctcgatgcccatcttctcctcacccttcaatggtgtccgtgac
cgggcttatgtggctgtggacggggtcccccaaggaatccttgagcgaaaccgtgtgata
tccctggacatacaggggaaagctggagccgttctggacattctggtggagaacatggga
cgtgtgaactatggcagaggcataaatgattttaagggtttgatttctaacatgactctt
aacttcagtattctcaccaattggacaatctttccactggacactgaggctgcagtacgc
acccatcttggggcctgggaggcccgtgatgagggccaccacgatggacgcttgaccttt
ggctcttcgaactttacgctccccacgttttatgtgggcaacttctccattccctcgggc
atcccagatctgccgcaggataccttcattcagtttcctggatggaccaagggtcaggtg
tggatcaacggctttaaccttggccgatactggcctgcacggggcccacaggtgaccttg
tttgtgcccaggcacattctgacgacgtcagccccaaacaacatcacggtgctggagctg
gaacgctcaccctgcagtgatgggacctcagagctgtgtaccgtggagtttgtcgacagg
ccgattattggcaggtccctggccatcagcggcccttttccagatcggtctggccaagac
tggtggctgaaccccctgtga

DBGET integrated database retrieval system