KEGG   Cricetulus griseus (Chinese hamster): 100768098
Entry
100768098         CDS       T02813                                 

Gene name
Abl1
Definition
(RefSeq) tyrosine-protein kinase ABL1 isoform X2
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04110  Cell cycle
cge04360  Axon guidance
cge04722  Neurotrophin signaling pathway
cge05200  Pathways in cancer
cge05206  MicroRNAs in cancer
cge05220  Chronic myeloid leukemia
cge05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100768098 (Abl1)
   04014 Ras signaling pathway
    100768098 (Abl1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100768098 (Abl1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100768098 (Abl1)
  09158 Development and regeneration
   04360 Axon guidance
    100768098 (Abl1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100768098 (Abl1)
   05206 MicroRNAs in cancer
    100768098 (Abl1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100768098 (Abl1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100768098 (Abl1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cge01001]
    100768098 (Abl1)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100768098 (Abl1)
Protein kinases [BR:cge01001]
 Non-receptor tyrosine kinases
  ABL family
   100768098 (Abl1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase F_actin_bind SH2 SH3_1 SH3_2 SH3_9 SH3_3 Kinase-like SH3_6
Other DBs
NCBI-GeneID: 100768098
NCBI-ProteinID: XP_027279670
LinkDB
Position
6
AA seq 1141 aa
MGQQPGKVLGDQRRPSLPALHFIKGAGKRDSSRHGGPHCNVFVEHEALQRPVASDFEPQS
LSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCE
AQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQR
SISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRN
KPTIYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVE
EFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVSAVVLL
YMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKF
PIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERP
EGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKRGTRGAAGS
MLQAPELPTKTRTCRRAAEQKDAADAPELLHMKGLGESDVLDSEPAVSPLLPRKERGPPD
GTLNEDERLLPKDKKTNLFSALIKKKKKMAPTPPKRSSSFREMDGQPERRGPSEDDGRDI
INGPPALTPSDAAEPTKSPKASNGAGVPNGAFREPGSSGFRSPNLWKKSSTLTSSRLAAS
EEESGISSSKRFLRSCSASCMPHGARDTEWRSVTLPRDLPSAGKQFDSSTFGGHRSEKPA
LPRKRASETRSEQVARGTVTPPPRLVKKSEEAADEVFKDMESSPGSSPPSLTPKLLRRQV
TASPSSGLSHKEETTKGNALGTPATAEPTPPSSRVGLNKASSEESRVRRHKHSSESPGRD
KGRLSKLKPAPPPPPASAGKAGKSAQSLGQEVAGEAGGAAKTKCSSLVVDAVNSDPTKAG
QPGEGLRKPVSPSVPKPQSTSKPPGTPTSPVSTAPTAPTPSSLPGDQPSSAAFIPLISTR
VSLRKTRQLPERIASGTITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVS
YVDSIQQMRNKFAFREAINKLESNLRELQICPATASSGPAATQDFSKLLSSVKEISDIVQ
R
NT seq 3426 nt   +upstreamnt  +downstreamnt
atggggcagcagcctggaaaagttcttggggaccaaagaaggcctagtttgcctgccctt
cattttatcaaaggggcagggaagagggactcatcgcggcatgggggtccacactgcaac
gtgttcgtggaacatgaagccttgcagaggccagtggcatctgactttgagccccagagt
ctcagtgaagcagctcgatggaactccaaggaaaaccttcttgctgggcccagtgaaaat
gaccccaacctttttgtggcactatatgattttgtggccagtggagataacactctcagc
atcactaaaggtgaaaagctccgggtcttaggttataatcacaatggggaatggtgtgaa
gcccaaacgaaaaatggccaaggatgggtaccaagcaactacatcacccctgtcaacagt
ctggagaaacattcctggtatcatgggcctgtgtcccgaaatgccgctgagtatctgctg
agcagtgggatcaacggcagcttcttggtgcgggagagtgagagtagtcctggccagagg
tccatctccctgagatatgaagggagggtataccactacaggatcaacaccgcctctgat
ggcaagctctacgtctcctcggagagccgcttcaacactctggctgagttagttcaccac
cattccacggtggctgatgggctcatcaccacgctccactacccagctcctaagcgcaac
aagccaaccatctacggcgtgtcccccaactatgacaagtgggaaatggagcgcaccgac
atcaccatgaagcacaagttgggtggaggccagtatggggaggtgtacgaaggtgtgtgg
aagaagtacagcctgactgtggctgtgaagaccttgaaggaggacaccatggaagtggaa
gagttcctgaaggaggctgcagtgatgaaggagatcaaacatcctaacctggtacagctg
ctaggggtgtgtacccgggagcccccattctacatcatcacggagttcatgacctatggt
aacctgctggactacctaagagagtgtaaccggcaagaggtgagcgctgtggtgctgctc
tacatggccacacagatctcatcagccatggagtacctggagaagaagaacttcatccac
agagaccttgctgctcgaaactgcctggttggggaaaaccatttggtgaaggtggctgat
tttggcctaagcaggttgatgacaggggacacctatacggcccatgctggagccaaattc
cccatcaagtggaccgcgcccgagagcctggcctacaacaagttctctatcaagtcagac
gtctgggcatttggagtattgctctgggaaattgctacctatggcatgtcaccttaccca
ggaattgacctgtcacaggtttatgagctgctggaaaaagactaccgtatggagcgccct
gaaggctgcccggagaaggtctatgaactcatgcgagcatgttggcagtggaatccctct
gaccggccctcctttgctgaaatccaccaagcctttgaaaccatgttccaggagtccagt
atctcagatgaagtggagaaggagctggggaagcggggcacgagaggagctgctggcagc
atgctgcaggccccagagctgcccaccaagaccaggacctgccggagagctgcagagcag
aaagacgcagctgatgcccccgagcttctccacatgaaaggcctgggagaaagcgatgtg
ctggacagtgagcctgctgtatcaccactgcttcctcgaaaagagcgtgggcccccagat
ggcaccctaaatgaagatgaacgccttcttcccaaggacaaaaagaccaacttgttcagc
gccttgattaagaagaagaagaaaatggcgccaacgcccccgaagcgcagcagctccttc
cgtgagatggatggccagccagaacgcagagggcctagtgaggatgatggccgggacatc
atcaacgggccaccagctctcaccccctcagatgcagcagagcctaccaagtccccaaag
gccagcaatggggctggtgtccccaatggagcatttcgggagccaggcagctcgggcttc
cgttctcccaacctgtggaaaaagtccagcacactgaccagcagccgcctggctgccagt
gaagaggagagtggcatcagctccagcaagcgattcctgcgctcttgctcagcctcctgc
atgccccatggggccagggacacagagtggcggtcagtcacgctgcctcgggacctgccg
tctgctggtaagcagtttgactcatccacctttggaggacacaggagcgaaaagccagct
ctgcctcggaagcgtgccagtgagaccaggtctgagcaggtggccagaggcaccgtgact
ccccctccccggctggtgaagaagagcgaggaggctgctgatgaagtcttcaaggacatg
gaatccagcccaggctccagccctcccagcttgactcccaagctcctccgtcggcaggtc
actgcctctccttcctctggcctctctcacaaggaagagaccaccaagggcaatgccttg
gggactcctgctactgctgagccaacaccccccagcagcagagtgggccttaacaaggcc
tcctctgaggagagccgagtaaggaggcacaaacacagctcagagtccccagggagagac
aaggggcggctgtccaagctcaagcctgccccaccacctccacctgcctctgcagggaaa
gccggaaagtctgcgcagagccttggccaagaagtggctggcgaggcaggtggggctgcc
aagacaaaatgctcaagtctggttgtggatgctgtgaacagtgaccccaccaaggctggc
cagcctggagaaggactaagaaagcctgtttccccatctgtgccaaagcctcagtccacc
agtaagcctccagggacccccaccagcccggtctccacagcccccacagcgccaacacct
tcatccctgcctggggatcagccatcttctgccgccttcatccccctcatatcaacccgt
gtgtctcttcgaaagacccgccaactgccggagcgcattgccagtggcaccatcaccaag
ggtgtggttctggacagcactgaggccctgtgtcttgccatctcccggaactcagagcag
atggccagccacagtgctgtgctggaggctggcaagaacctgtacacgttctgtgtgagc
tacgtggactccatccagcagatgaggaacaagtttgccttccgtgaggccatcaacaag
ctggagagcaacctccgagagctgcagatctgtcctgcgacggcttccagtggcccagct
gccacacaggacttcagcaagctgcttagctctgtgaaggagatcagcgacatcgtacag
aggtag

KEGG   Cricetulus griseus (Chinese hamster): 100768252
Entry
100768252         CDS       T02813                                 

Gene name
Bcr
Definition
(RefSeq) breakpoint cluster region protein isoform X2
  KO
K08878  breakpoint cluster region protein [EC:2.7.11.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge05200  Pathways in cancer
cge05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cge00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100768252 (Bcr)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100768252 (Bcr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cge01001]
    100768252 (Bcr)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    100768252 (Bcr)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100768252 (Bcr)
Protein kinases [BR:cge01001]
 Serine/threonine kinases: Other
  BCR family
   100768252 (Bcr)
Membrane trafficking [BR:cge04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    100768252 (Bcr)
SSDB
Motif
Pfam: RhoGAP Bcr-Abl_Oligo RhoGEF PH_19 C2 PH IQ_SEC7_PH PH_5
Other DBs
NCBI-GeneID: 100768252
NCBI-ProteinID: XP_027249998
LinkDB
Position
1
AA seq 1275 aa
MVDSVGFAEAWRAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQ
TLLAKEKKSYDRQRWGFRRAAQPPDGAAEPRAPAPRPPPAPADGADPAPAVEESEARPDG
EGSPGKARPPPAARRPAAAAPAERDERGPPTSVAALRSNFEKIRKGPAQPGSGDAEKPFY
VNVEFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQQSAGQGLGEAPRPHYRGRTSE
SSCGLDGDYEDAELNPRFLKDNLINANGGNRPPWPPLEYQPYQSIYVGGMMVEGDGKGPL
LRSQSTSEQEKRLTWPRRSYSPRSFEDSGGGYTPDCSSNENLTSSEEDFSSGQSSRVSPS
PTTYRMFRDKSRSPSQNSQQSFDSSSPPTPQCQKRHRQCQVVVSEATIVGVRKTGQIWPS
DGDSTFQGDADSSFGTPPGYGCAADQAEEQRRHQDGLPYIDDSPSSSPHLSSKGRGGREA
LASGALEPSKANELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQP
VLTSQQIETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVD
NYGVAMETAEKCCQANAQFAEISENLRARSNKDAKDSATKNSLENLLYKPVDRVTRSTLV
LHDLLKHTPSSHPDHSLLQDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMV
ELVEGARKLRHIFLFTDLLLCTKLKKQSGGKTQQYDCKWYIPLTDLSFQTVDELEAVPNI
PVVPDEELDALKIKISQIKSDIQREKRANKGSKVMERLRKKLSEQESLLLLMSPSMAFRV
HSRNGKSYTFLISSDYERAEWRESIREQQKKCFKSFSLTSVELQMLTNSCVKLQTVHHIP
LTINKEDDESPGLYGFLNVIVHSATGFKQSSNLYCTLEVDSFGYFVNKAKTRVYRDTTEP
NWNEEFEIELEGSQTLRILCYEKCYNKTKITKEDGESADKLMGKGQLQLDPQTLQDRDWQ
RTVIDMNGIEVKLSVKFTSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVE
EIERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELP
EPLFTDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLVTFLFLLDHLKRVAEKETVN
KMSLHNLATVFGPTLLRPSEKESKLPANPTQPITMTDSWSLEVMSQVQVLLYFLQLEAIP
APDSKRQSILFSTEV
NT seq 3828 nt   +upstreamnt  +downstreamnt
atggtggactccgtgggcttcgccgaggcgtggagggcgcagttcccggactcggagccg
ccgcgcatggaactgcgctcggtgggtgacatcgagcaggagctggagcgctgcaaggcc
tccatcaggcgcttggagcaggaggtgaaccaggagcgcttccgcatgatctacctgcag
acgctgctggccaaggagaagaagagctacgaccggcagcgctggggcttccggcgcgca
gcgcagcccccggacggcgccgccgagccccgagctcccgccccgcgcccgccgcccgct
cccgccgacggcgctgacccggcgcccgccgtcgaggagtccgaggcgcggccggacgga
gaagggtcaccggggaaggcacgcccgccgcccgccgcccgcaggccagcggccgcagcg
ccggcggagcgggacgagcgagggccccccaccagcgtggcggcactcagatcgaacttc
gagaagatccgcaagggacctgcccagcccggctctggcgacgctgagaagcccttctac
gtgaacgtcgagtttcaccacgagcgcggcctggtgaaggtcaacgacaaagaggtgtcg
gaccggatcagttctctaggcagccaggccatgcaaatggagcgcaagaagtcccagcag
agcgccgggcagggtctgggtgaagcgcccagaccccactaccgaggacgcacctcggag
agcagctgcggcctcgacggtgactacgaggatgcggagttgaatccccgcttcctgaag
gacaacctcatcaacgccaacggcggcaacaggcccccttggccgcccctggagtaccaa
ccctaccagagcatctacgtcggaggtatgatggtggaaggggacggcaagggcccgctc
ctgcgaagccagagcacttcagagcaggagaagcgcctcacctggccccgcaggtcctac
tccccccggagttttgaggacagcggaggtggttacaccccggactgcagctccaatgag
aacctcacttccagcgaggaggacttttcctctggccagtccagccgcgtgtcacccagc
cccaccacctaccgtatgttcagggacaagagccgctcaccctcgcagaattcgcagcag
tcctttgacagcagcagccccccgacgccacagtgccagaaacggcaccggcagtgccag
gttgtggtgtctgaggctaccatcgtaggggtccgcaagaccgggcagatctggcccagt
gatggggacagcaccttccagggggatgcagattcctcgttcggaacaccacctgggtat
ggctgtgccgcagaccaggccgaggaacagcgccggcaccaggatgggctgccctacatc
gatgattcaccttcttcctctccacacctcagcagcaaaggcagaggcggccgcgaggct
ctggcctcaggagccctggagcccagcaaagcgaatgaactggatttggaaaagggcttg
gagatgagaaagtgggttctatctggaatcctggccagcgaggagacatacctgagccat
ctggaggccctgctgctgcccatgaagcccctgaaagctgctgccaccacctctcagccc
gtgctgaccagccagcagatcgagaccattttcttcaaagtgcctgagctctacgagatc
cacaaggagttttacgatgggctgttcccccgtgtgcagcagtggagccaccaacagcgt
gtgggtgacctcttccagaagctggccagccagctgggtgtgtaccgagcctttgtggat
aactacggagtggccatggaaactgcagagaaatgctgtcaggccaacgctcagtttgca
gagatatccgagaacctgagagccaggagcaacaaggacgccaaggactcagccaccaag
aactctttggaaaatctgctctacaagcctgtggaccgggtgacgaggagcacactagtc
cttcatgacttgctaaagcacactccatccagccatcctgaccattccctgcttcaggac
gccctccgcatctcacagaacttcctctccagcatcaatgaggagatcacaccacgtcgg
cagtccatgacggtgaaaaaaggagagcaccggcagctgctcaaggacagcttcatggtg
gagctggtggagggggcccgcaagctgcgtcacatattcctattcaccgacctgctcctg
tgcaccaagctgaagaagcaaagtggagggaaaacccagcaatatgactgtaaatggtac
attccgctcacggatctcagcttccagacggtggatgaattggaggcggtgcccaacatc
cctgtggtgccggatgaggaactggacgccttgaagatcaaaatctcccaaatcaagagt
gacatccaacgagagaagagggcaaacaagggcagcaaagtcatggagaggctgaggaag
aagctgtcagagcaagagtcactgctactgttaatgtcccccagcatggccttcagggta
cacagtcgcaatggcaagagttacacattcctgatctcctccgactatgagcgggccgag
tggagagaaagcatccgggagcagcagaagaagtgtttcaagagtttctctctgacatca
gtggagctgcaaatgctgaccaattcgtgtgtaaaacttcagacagttcaccacattcca
ctgaccatcaacaaagaggatgatgagtctcccgggctctacggcttcctgaatgtcatc
gtccactcagccacggggtttaagcagagttcaaatctgtactgcaccctggaggtggat
tcctttgggtattttgtgaataaagcgaagactcgagtctacagggacacaactgagcca
aactggaatgaggagtttgagatagagctggaaggctcccagacccttcggatactgtgc
tatgaaaagtgttacaacaaaacgaagattaccaaggaggatggcgagagcgcagacaag
ctcatggggaaaggccagctccagctggacccccaaaccctgcaggacagagactggcaa
cggactgtcattgacatgaatgggattgaagtgaaactttccgtcaagttcacgagcaga
gagttcagcttgaagagaatgccttcccgaaaacagacaggggtcttcggtgtcaagatt
gctgtggtcacaaagagagagaggtccaaggtaccttacattgtgcgtcagtgtgtggaa
gagatcgagcgccggggcatggaggaggtgggcatctaccgagtatccggagtggccaca
gacatccaggcactgaaggcggcctttgatgtcaataataaggatgtgtcggtgatgatg
agcgagatggatgtgaacgccattgctggcacgctgaagctctacttccgtgagctgccc
gagcccctcttcactgatgagttctaccctaacttcgcagagggcatcgctctttcagac
cctgttgcaaaggagagctgcatgctcaacttgctgctgtccctcccagaagccaaccta
gtgaccttccttttccttctggaccacttgaaaagggtggctgagaaggagacagtgaac
aagatgtccctccacaacctcgccacagtctttggccccacgctgcttcgaccctcagag
aaggaaagcaagctccctgctaaccccacccagcccatcaccatgactgacagctggtcc
ctggaggtcatgtcccaggtccaagtgttgctgtatttcctgcagctggaggccatccct
gcccccgacagcaagagacagagcatcctgttttccactgaggtctaa

DBGET integrated database retrieval system