KEGG   Cricetulus griseus (Chinese hamster): 100768233
Entry
100768233         CDS       T02813                                 

Gene name
Rheb
Definition
(RefSeq) GTP-binding protein Rheb isoform X2
  KO
K07208  Ras homolog enriched in brain
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04072  Phospholipase D signaling pathway
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04152  AMPK signaling pathway
cge04211  Longevity regulating pathway
cge04218  Cellular senescence
cge04714  Thermogenesis
cge04910  Insulin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05168  Herpes simplex virus 1 infection
cge05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100768233 (Rheb)
   04151 PI3K-Akt signaling pathway
    100768233 (Rheb)
   04152 AMPK signaling pathway
    100768233 (Rheb)
   04150 mTOR signaling pathway
    100768233 (Rheb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100768233 (Rheb)
  09143 Cell growth and death
   04218 Cellular senescence
    100768233 (Rheb)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100768233 (Rheb)
   04919 Thyroid hormone signaling pathway
    100768233 (Rheb)
  09149 Aging
   04211 Longevity regulating pathway
    100768233 (Rheb)
  09159 Environmental adaptation
   04714 Thermogenesis
    100768233 (Rheb)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100768233 (Rheb)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100768233 (Rheb)
   05163 Human cytomegalovirus infection
    100768233 (Rheb)
   05165 Human papillomavirus infection
    100768233 (Rheb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:cge04031]
    100768233 (Rheb)
GTP-binding proteins [BR:cge04031]
 Small (monomeric) G-proteins
  Ras Family
   Rheb
    100768233 (Rheb)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB
Other DBs
NCBI-GeneID: 100768233
NCBI-ProteinID: XP_027284221
UniProt: G3HB55
LinkDB
Position
8
AA seq 184 aa
MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD
TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK
KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFKRIILEAEKIDGAASQGKSS
CSVM
NT seq 555 nt   +upstreamnt  +downstreamnt
atgccgcagtccaagtcccggaagatcgccatcctgggctaccggtctgtggggaagtcc
tcattgacaattcagtttgttgaaggccaatttgttgactcctatgatccaaccatagaa
aacactttcacaaagttgatcacagtaaatgggcaagagtatcatctccagcttgtagac
acagcagggcaggatgaatattccatttttcctcagacatactccatagatattaatggt
tatattcttgtgtattctgttacatcaatcaaaagttttgaagtaattaaagttatccat
ggcaagttgctggatatggtggggaaagtgcagatacctattatgttggttggaaataag
aaggacctgcatatggaaagggtgatcagttacgaagaagggaaagctttggcagaatct
tggaacgcagcttttttggaatcttctgcaaaggaaaatcagactgccgttgatgttttt
aaaaggataattttggaagcagaaaagattgatggggcagcttcacaaggaaagtcttca
tgctcggtgatgtga

DBGET integrated database retrieval system