KEGG   Cricetulus griseus (Chinese hamster): 100768628
Entry
100768628         CDS       T02813                                 

Gene name
Mecom
Definition
(RefSeq) histone-lysine N-methyltransferase MECOM isoform X1
  KO
K04462  [histone H3]-lysine9 N-methyltransferase (ecotropic virus integration site 1 protein) [EC:2.1.1.367]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00310  Lysine degradation
cge01100  Metabolic pathways
cge04010  MAPK signaling pathway
cge05200  Pathways in cancer
cge05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100768628 (Mecom)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100768628 (Mecom)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100768628 (Mecom)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100768628 (Mecom)
Enzymes [BR:cge01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.367  [histone H3]-lysine9 N-methyltransferase
     100768628 (Mecom)
Transcription factors [BR:cge03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 PRDM
    100768628 (Mecom)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100768628 (Mecom)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-C2H2_11 zf-met zf-BED zf-C2H2_8 Zn-ribbon_8 Sigma54_activat PyrI_C
Other DBs
NCBI-GeneID: 100768628
NCBI-ProteinID: XP_035307034
LinkDB
Position
1
AA seq 1043 aa
MKSEDDPHEPMAPDIHEERQHRCEDCDQLFESKAELADHQKFPCSTPHSAFSMVEEDLQQ
NLESESDLREIHGSQDCKECDRVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIR
HQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHKH
IHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCE
GKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLADYFGTNRHPAGLTFPTAPGFS
FSFPGLFPSGLYHRPPLIPASPPVKGLSSTEQSNKCQSPLLTHPQILPATQDILKALSKH
PPVGDNKPVELLPERSSEERPLEKISDQSESSDLDDVSTPSGSDLETTSGSDLESDLESD
KEKCKENGKMFKDKVSPLQNLASINNKKEYSNHSVFSASVEEQTAVSGAVNDSIKAIASI
AEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLPLKMEPQSPS
EVKKLQKGSSESPFDLTTKRKDEKPLTSVPSKPPATPATSQDQPLDLSMGSRSRAGGTKL
AEPRKNHVFGEKKGSNMEARSTSDGSLQHARPTPFFMDPIYRVEKRKLTDPLEALKEKYL
RPSPGFLFHPQMSAIENMAEKLESFSALKPEASELLQSVPSMFSFRAPPNTLPENLLRKG
KERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKP
FKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELESTGAILDDKEDAYFTEIRN
FIGNSNHGSQSPRNMDERMNGSHFKDDKALVTSQSSDLLDDEEVEDEVLLDEEDEDNDIP
GKSGKELGTTNLDEEIPEDDYEEAGTLEMSCKTSPVRYKEEDYKSGLSALDHIRHFTDSL
KMRGMEENQYTDAELSSFSSSSLVPEELKQPLHRKSKSQAYAMMLSLSDKDPIHPTSHSS
SNVWHSMARAAAESSAIQSISHV
NT seq 3132 nt   +upstreamnt  +downstreamnt
atgaagagtgaagacgatccccatgagcccatggcgcctgacatccatgaagaacggcag
caccgctgcgaggactgtgaccagctcttcgaatccaaggctgaactagcagatcaccag
aagttcccatgtagcacacctcactcagcattctccatggtggaagaggacttacaacaa
aaccttgagagtgagagtgacctccgagagatccatggcagccaggactgtaaggaatgt
gacagagttttccccgatctgcaaagcttggagaagcacatgttgtcacatacggaggag
agggaatacaagtgtgatcagtgtcccaaggcatttaactggaagtccaatttaattcgc
caccagatgtcacatgacagtggaaagcactatgagtgtgaaaactgtgccaaggttttc
acggaccctagcaaccttcagcgacacattcggtctcaacatgtcggtgcccgggcacat
gcttgcccggagtgcggtaaaacatttgccacttcgtcaggcctcaaacaacacaagcac
atccacagcagtgtgaagccctttatctgtgaggtctgccataaatcctatactcagttt
tcaaacctttgtcgtcataagcgcatgcatgctgattgcagaacccaaatcaagtgcaaa
gactgtggacaaatgttcagcactacgtcttccttaaataaacacaggaggttttgtgag
ggcaagaaccattttgcggcaggtggattttttggccaaggcatttcacttcctggaacc
ccagctatggataaaacgtccatggttaatatgagtcatgccaacccgggcctggctgac
tattttggcaccaataggcatcctgctggtcttacctttccaacagctcctggattttcc
tttagctttcctggtctgtttccttcaggcttgtaccacaggcctcctctgatacctgct
agtcctcctgttaaaggactatcaagtactgaacagtcaaacaaatgtcaaagtcccctc
ttgacacatcctcagatactgccagccacacaggatattttgaaggcactatctaaacac
ccacctgtaggggacaataagccagtggaactgctgcccgagaggtcctctgaagagagg
ccccttgagaaaatcagtgaccagtcagagagtagtgaccttgatgatgtcagtacacca
agtggcagtgacctggagacaacctcgggctctgatctggaaagtgaccttgaaagtgat
aaagagaaatgtaaagaaaatggtaaaatgttcaaagacaaagtaagccctctgcagaat
ctggcttcaataaataataagaaagaatacagcaatcattccgttttctcagcatctgta
gaggagcaaactgcggtgtcaggagctgtgaatgattctataaaggctattgcgtctatt
gctgaaaaatactttggttccacaggactggtggggctgcaagacaaaaaagtcggagcg
ttaccttacccttccatgtttcccctcccattttttccagcattctctcaatcaatgtac
ccatttcctgatagagacttgaggtcgttacctttgaaaatggaaccccaatcaccaagt
gaagtaaagaaactgcagaagggaagctctgagtccccttttgacctcaccactaagcga
aaggatgagaagcctttgacttcagtcccctcgaagcctccagcaacacctgccacaagc
caagaccagcccctggatctaagtatgggcagtaggagtagagcaggtgggacaaagctg
gctgagcctcggaaaaaccatgtatttggggaaaagaaaggaagcaacatggaagcaaga
tcaacttcagatggctccttgcagcatgcgagacctactcccttcttcatggaccccatt
tatagagtagagaaaagaaagctcaccgacccacttgaagctttgaaagaaaaatacttg
agaccttctccaggcttcttatttcacccacaaatgtcagctattgagaacatggcagaa
aagctagagagcttcagcgccctgaagcctgaggccagtgagctccttcagtccgtgccc
tcgatgttcagcttcagagcacctcctaataccctgcctgagaacctgctgcggaagggg
aaagaacgctacacctgcagatactgtggcaagattttcccaaggtctgcgaacctgacc
cgccacttgagaacccacacaggggagcagccgtacagatgcaaatactgtgatagatca
ttcagcatttcctccaatctgcagcgacatgtccgcaacatccacaacaaggagaaacca
tttaagtgtcacttatgtgatagatgttttggtcaacaaaccaatcttgacagacaccta
aagaaacatgagaatggaaacatgtctggtacagcaacatcttcacctcattcagaacta
gaaagcacaggtgcaatcctggatgacaaagaagatgcttacttcacagagatccggaat
ttcattggaaatagcaaccatggtagtcagtctcctcggaacatggatgagaggatgaat
ggtagtcacttcaaggatgacaaggctttggtaaccagccagagttctgatttactggat
gatgaagaagtagaagatgaagtgctgttggatgaggaggatgaagacaatgacattcct
ggaaaatctggaaaggagctggggacaactaatttagatgaagaaatcccagaggatgac
tatgaggaagcaggcaccctggagatgagttgtaagacatccccggtgaggtataaagag
gaagactataaatctggcctttctgctctagatcacataaggcacttcacagacagcctc
aaaatgaggggaatggaggagaatcaatacactgacgctgagctgtcttcctttagttct
tcttctcttgtgccagaggagcttaaacagccgttacacagaaagtccaagtcacaggca
tatgctatgatgttgtcactgtcagacaaggatccaattcatcccacctcccacagttcc
tccaacgtgtggcacagcatggcaagggctgcagcagaatccagtgccatccagtccata
agccatgtatga

DBGET integrated database retrieval system