KEGG   Cricetulus griseus (Chinese hamster): 100769016Help
Entry
100769016         CDS       T02813                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal-like
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00052  Galactose metabolism
cge00500  Starch and sucrose metabolism
cge01100  Metabolic pathways
cge04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100769016
   00500 Starch and sucrose metabolism
    100769016
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100769016
Enzymes [BR:cge01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100769016
    3.2.1.20  alpha-glucosidase
     100769016
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil DUF5110 Gal_mutarotas_2 ODV-E18
Motif
Other DBs
NCBI-GeneID: 100769016
NCBI-ProteinID: XP_007618016
LinkDB All DBs
Position
Un
AA seq 1817 aa AA seqDB search
MARPRFKKFSKLELTLIVLLLVLFIIAVVLIVLLANSTPQNDPGTTGTPHSTTPRISTPD
TTVLRTSTPDSTSRTTPSHCPVLSEQERINCIPDKSPNKTICDQRGCCWDPQGAGNAICY
FSKNHGYQMESDPVITNAGLTAQLKNLPSAPLFGSEIENVLLTAEYQTPNRFHFKFTDPT
KDRYEVPHEHVQPFSGNAASSLNYRVEVFKQPFSIKVTRKSNNRVLLDTSIGPLLFSDQF
LQLSTYLPSANVYGLGEHVHQRYRHDMNWKTWPLFSRDTTPNKDGNNLYGVQTFFLCLED
NSGLSFGVFLMNSNAMEVTLQPTPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPA
LPSYWALGFQLSRYDYGSLDNMKAVVDRNRAVQLPYDVQHADIDYMDQRKDFTYDPVKFS
GFPEFAEDLHLNRQKLIIILVLNFFFHXXXXDPYDPYDKGSAMNIWVNSSDGINPLIGEV
WPGITVFPDYTNPNCAVWWAEEINSFHNKVKFDGIWIDMNEVSNFVDGSVSGCSTNDLNY
PPFTPKILDGHLFSKTLCMDAVQYWGRQYDVHSLYGYSMAIATSEAVKATFPEKRSFIIT
RSTFAGSGKFAAHWLGDNSATWEDLQWSVPGMLEFNLFGIPMVGADICGFALNTTEELCR
RWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLLYHAH
SRGDTVARPLLHEFYKDNNTWDIDRQFLWGPGLLITPVLEEASEKVKAYLPDAIWYDYET
GAQVTWRKQSIDMELPGDKIGLHLRGGYIFPTQQPDTTTADSRKNPLGLIIALDENKEAR
GELFWDDGETKDTVTKNTYIFSEFSVTQNHLNVTISSASYKDPNNLEFQEIKILGTQAIY
NVKVKQNGVLSSMSPQITYNSNLKVATITDLHLVLGEPYTVEWSNMTDEEKIDCYPDEHG
ASEANCTARGCIWEESDTPGVPYCFFASDLYSVSNVQYHQNEATADISLKDSPYSNAFPS
TPVKQLQVQVIYHKNEMLQFKIYDPNHSRYEVPVPLNIPSSPSSTTDGRLYDVLIKENPF
GIEIRRKSTGTVIWDSQLLGFTFNDMFIRISTRLPSTHIYGFGETEHTSFKIDLDEPVSL
IVYVTFQPTPALTYRTTGGVLDFYVFLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCRY
GYENDTEIASLYDEMVAKQIPYVCASVEDLTCSTHYAFSELCDLPKTLANLSFLKCERQT
TFSTINRMKRDGMRVILILDPAISGNETEPYPAFTRGLQEDVFIRYPNGGDIVWGKVWPD
YPGIVVNSSLDWDSQVEQYRAYVAFPDFFRNSTVTWWKKEIEELHTNPQNPTKSLKFDGL
WIDMNEPSSFVNGAVPPGCSDATLNRPPYMPHLEARDRGLSSKTLCMESEQILPDGSRVR
HYDVHSLYGWSQTRPTYVAVQEVTGERGIVITRSTFPSSGRWAGHWLGDNTAAWNQLGKS
IIGMMEFSLFGISYTGSDICGFFQDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSW
DEAFEDISRSVLETRYTLLPYLYTLMYKAHTEGSTVVRPLLHEFVADRETWNIDRQFLLG
PAFLISPVLEPNARTVDAYFPRARWYDYYTGADINARGQWKTLPAPLEHINLHVRGGYIL
PWQEPAMNTHLSRRKLMGLKVALDDEGNAEGWLFWDDGQSINITSRYYLARFSVSENTLW
RHEIFNNYITGTSPVYLGYIEIWGLGTVSPNSVKIFWNSKNEIVPADYNTQSQVLKVNVT
TKGIGLHRFEAMTWNSS
NT seq 5454 nt NT seq  +upstreamnt  +downstreamnt
atggcgagaccaaggtttaaaaagttcagcaaattggagcttacactcattgtcctgctg
cttgtgttgttcatcatcgctgtggttctgattgtgctcttagccaattctacaccgcaa
aatgatcctggcacaactggcaccccacactctacaaccccaagaattagcactccagac
actacagtcctaagaactagcacgccagactctacctcaagaaccactccttcccactgc
ccagttctaagtgaacaggaacggataaattgcatccctgacaagtcacctaacaagacc
atatgtgaccagcgtggctgctgctgggatccccagggagcgggaaatgctatttgctac
ttttccaagaatcatggctaccaaatggagagtgatcctgtgattacaaatgcaggactc
acggctcagttgaaaaacttgccctctgcacccctgtttggaagtgaaattgaaaatgtc
ttgctcacggcggagtaccagacaccgaatcgcttccattttaagtttactgacccaacc
aaggacaggtatgaagtccctcatgaacatgtgcaacccttcagtggaaacgctgcttct
tccttgaactaccgagttgaggtctttaaacaaccatttagcatcaaagtcaccagaaaa
agcaacaaccgtgtgctgcttgacacaagtattgggcctctcctcttctctgaccagttc
ctgcaactctcaacctaccttccaagtgctaatgtgtacggtctgggagagcacgtgcac
caacggtacaggcatgacatgaactggaagacctggcccttgttttccagggacacaacc
cccaataaggatggaaataacttgtatggtgtgcagaccttcttcctgtgccttgaagac
aatagtggattatcctttggggtgtttctgatgaacagcaatgccatggaggttaccctt
cagcccaccccagcaatcacataccgcaccattgggggaattctggacttctatgtgttc
ttggggaacacacccgaacaagttgttcaagaatatctagagctcattgggcggccagct
ctgccttcatactgggcacttgggtttcagctcagccggtatgactatggaagcctagac
aatatgaaagcagttgtggacaggaaccgtgcagtacaactcccttacgatgttcagcat
gctgatattgattatatggatcagaggaaggatttcacttatgacccagtgaagttttca
ggcttcccggagtttgctgaggacttacaccttaataggcagaaacttattatcattttg
gtattaaattttttttttcattnnnnnnnnnntgatccctatgacccatatgataaaggt
tcagcaatgaatatctgggtgaatagttctgatggcataaacccactcattggagaggtc
tggcctggaataactgtgtttcctgattacaccaatcccaactgtgctgtttggtgggca
gaggaaattaatagtttccacaataaagtgaaatttgatggaatttggattgatatgaac
gaagtctccaactttgttgatggctcagtttcaggatgttccacaaatgacctcaattat
cctcctttcacaccaaagatcctggatgggcacttgttctctaagactctctgcatggat
gctgttcagtactggggcaggcagtatgacgtccacagtctgtatggctactccatggcc
attgccacatcagaagccgtgaaggctacatttccagagaagagaagcttcatcatcaca
cggtccacctttgcgggatctggcaagtttgcagcccactggttaggagacaactcggcc
acctgggaggaccttcagtggtctgttccaggcatgcttgagttcaaccttttcggcatc
ccaatggtaggggctgacatatgtggctttgccttgaacacgactgaggagctctgcagg
cggtggatgcagctgggggcattttatccattttcccggaatcacaatggccagggctac
aaggaccaggatccggcctcttttggagcagattccttgctcttgaattcgtctaggcac
taccttaacatccgatacactctgctgccttacctctacactcttttataccacgcccac
agccggggagacaccgtggctaggccccttctgcatgagttctataaggacaacaatact
tgggacatagaccggcagtttctgtggggaccaggcctcctcatcactcctgttctggaa
gaggcaagtgagaaagtgaaggcatatctgcctgatgccatctggtatgactatgagacg
ggggcgcaagtgacatggagaaagcaaagcattgacatggaacttcctggagataaaatt
ggacttcaccttcgaggaggctacatcttccccacacaacagccagacacaaccacagca
gacagccggaagaaccctcttggtctgatcattgcgctggatgagaacaaagaagcccga
ggagaactgttctgggatgatggagagacaaaggatactgtgaccaagaacacttacatt
ttcagtgaattttctgtcacccaaaaccatttgaatgtgacaatttcaagtgcaagctac
aaggatcccaataacttagaattccaggaaattaaaatccttgggacacaggcaatttac
aatgttaaagtgaaacagaatggtgtccttagttcaatgtctcctcaaatcacttacaat
tcaaacctgaaggttgccaccatcacagatctccatctcgtgctgggagaaccatacact
gtcgagtggagtaacatgacagacgaggagaagatagactgctatccagatgagcatgga
gcttctgaggccaactgcactgcccggggctgcatctgggaggaatcggacactcctggg
gttccttattgcttctttgccagtgacctgtactcagtcagcaatgttcagtatcaccag
aacgaggccacagctgacatttccttgaaggattctccttatagcaacgccttcccctct
acacccgtgaagcaactgcaagtgcaagtgatctaccacaagaatgaaatgctgcagttc
aagatctacgatcccaaccacagtcggtatgaagtcccagtgcctctgaatatccccagt
tctccgtccagcacaactgacggccgtctctacgatgtcctcatcaaggagaatccattt
gggattgaaattcgcaggaagagtacaggcactgtgatctgggactctcagctccttggc
ttcaccttcaatgacatgtttatccgcatctccacccgcctgccctccacacacatctat
ggctttggggaaactgagcacacaagcttcaagatagacctggatgaacctgtgtccctt
attgtttacgtgacgttccagcccacgcctgctctcacataccgcaccacggggggagtt
ttggatttttatgtatttttggggccaactcccgaacttgtcactcagcagtacacagag
ttgattggtcggccagtgatggtaccttactggtccctgggattccagctgtgtcgctat
ggatatgagaatgacactgagatcgccagcttgtatgatgagatggtggctaagcagatc
ccctatgtatgtgcatctgttgaggatttgacgtgcagtactcactatgccttttctgag
ttgtgtgaccttccaaagacattagcaaatttaagtttcctaaagtgtgagaggcagaca
acattttccacgatcaatcgcatgaagagagatgggatgcgggtcatcctcattctggac
ccagctatttctggcaatgagacagagccctatcctgccttcacccgaggtctacaggag
gacgtctttatcagatatcccaatggtggagacattgtctggggaaaggtctggcctgat
taccctggtattgtggtgaacagttctctagactgggacagtcaagtggagcaatacaga
gcttatgtggccttcccagactttttccgtaattcaactgtcacgtggtggaagaaggag
attgaagaactccacacaaacccacagaatccaaccaagagcttgaagtttgatggcctg
tggattgatatgaatgaaccttccagctttgtgaatggggcagttcctccaggctgcagc
gatgctactctgaaccgtcctccctacatgccacatttggaagccagggacaggggcctg
agcagcaagactctgtgcatggagagtgagcagatccttccagatggctcccgggtgcgg
cactatgatgtgcacagcctgtatgggtggtcccagaccagacccacctacgtagctgtt
caggaggtgacaggagagagagggattgtcatcacacgctccacattcccctcttctgga
cgctgggcaggacactggctgggagacaacacagctgcctggaaccagctggggaagtcc
atcattggcatgatggagttcagtctctttggcatctcctatactgggtcagatatctgt
gggttctttcaagatgctgagtatgagatgtgtgttcgctggatgcagctgggagccttt
taccccttctccaggaaccacaacaccattgggaccaggagacaagaccctgtatcctgg
gatgaagcctttgaggatatttccagaagtgtgctggagaccagatacaccctgttgcca
tatctctacaccttgatgtacaaggcccacacggagggcagcacagttgtgcggcctctt
ctccatgagtttgtggcagaccgggagacctggaatatagacagacagttcctgctgggt
ccagccttcctcatcagccctgtgctggagccaaatgccagaactgtagatgcatatttt
cccagagcccgctggtatgactactacacaggtgcagatattaatgcaaggggacaatgg
aagaccttgccagcacctcttgagcacattaaccttcatgtccgtgggggctacatcctg
ccctggcaggagcctgccatgaacacccatctgagccgtcggaagctgatgggcctcaaa
gttgccttggatgatgaggggaatgctgagggatggctcttctgggatgacgggcaaagc
attaatatcacaagcagatactacttggccaggttttctgtcagtgagaacacattgtgg
agacatgaaatttttaacaattacatcactggcacatctcctgtgtacctaggctacatt
gaaatctggggattgggcactgtttcccctaatagtgtgaagatcttttggaacagcaag
aatgaaatagtccctgctgactacaacacccaaagccaggtactaaaagttaatgtgact
accaaaggaattggcctgcatcgttttgaggcaatgacatggaactcttcataa

DBGET integrated database retrieval system