KEGG   Cricetulus griseus (Chinese hamster): 100769303Help
Entry
100769303         CDS       T02813                                 

Gene name
Mgam2
Definition
(RefSeq) maltase-glucoamylase 2 (putative)
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00052  Galactose metabolism
cge00500  Starch and sucrose metabolism
cge01100  Metabolic pathways
cge04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100769303 (Mgam2)
   00500 Starch and sucrose metabolism
    100769303 (Mgam2)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100769303 (Mgam2)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100769303 (Mgam2)
    3.2.1.20  alpha-glucosidase
     100769303 (Mgam2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110 M157
Motif
Other DBs
NCBI-GeneID: 100769303
NCBI-ProteinID: XP_016823355
LinkDB All DBs
Position
Un
AA seq 1990 aa AA seqDB search
MARKLSVLEVLLITCNIVALAVDILLLLLVLEDPSGKDDGSLTPDCPNIAESERIDCAPG
QAVTEDVCRWQHKCCWKPAADPKAPACFFPRNWGYEVSNVRTNTSTGLTAQLKILPSPSL
FGNDIADALFTAEYQTSNRFHFKITDFNEMRYEVPHENANLLNGTAEKSLLNYYVEVINK
PFSIRIVRKSNKRVLLDTGIGPLQFAQQYLQLSFRLPSSNVYGLGEHVHQQYRHNMSWNT
WPIFTRDATPTEGMANLYGAHTFFLCLEDTSGASFGVFLMNSNAMEVTLQPAPAITYRTT
GGVLDFYILLGNTPEQVVQEYLEVVGRPFLPSYWSLGFQLSRRDYGGLDGLREVVHRNRD
AQIPYDVQYSDIDYMDGRKDFTIDEQAYPQLADFAKDLHNNEQKYVIILNPGIFKDLNYK
VYNNGSKSRVWIMSSSGFAVGEGYPGQSVFPDFTNPASTLWWTRQLTEFYSLLEFDGVWI
EMDELSTLLQGLNHKCESNNLNFPPFTPSVLNGSLLVGTLCMDTEFHSGLHYDVHSLYGY
TMSRATDLALETVFSSKRSFILSRSTFAGSGKFAAHWLGNNAATWDDLRWSIPSILEFNL
FGIPMVGANICGYRNNVTEELCRRWMQLGAFYPLSRNHNGPTYRDQDPAAFGSNSLLLES
SRHYLNIRYTLLPYLYTLFYRAHTFGETVARPLVHEFYQDQATWEVHEQFLWGPGLLITP
VLYEGMDQVRAYIPDAIWYNYETELAIEWRKQFVDMSLPGDRIGLHLRGGYIFPTQQPNT
TTESSRKNPLGLIVALDYKREAKGQLYWDDGVSKGTVLERKYILYDFSVTSNHLQAKIIN
NNYVDPNDLMFTDIRILGMDKEPTGLNVLFNNNAIPILSYNYNASTKVRVLVIDNLTGLK
LGQEFTIEWTLLVSDLEKFNCFPEDPAASEESCKQRGCLWEHTTIPGVPTCFYDTIPQYA
ASNIQYQPTGITMDLTLLADSASARAAAAPSIVSDPLSGKISSLKLHVTYHTENMLQVKI
YSSSNKRYEVPIPLNIPSSALGSSENCLYDVTVKTNPFGLEIRRKNSGTVIWDSQLPGFT
FSEMFLSISTRLPSQYIYGFGETEHESFRRNMSWNMWGMFARDEPPAYKKNSYGVHPYYM
ALEDDGNAHGVLLLNSNAMDVTLQPTPALTYRTIGGILDFYMVLGPTPELVTQQYTQLIG
RPAMTPYWALGFQLSRYGYQSDDEIANLYDAMVAAQIPYDVQHVDIDYMDRKLDFTLSPS
FQNLSVLINQMKTNGMRFILILDPAISGNETQYLPFTRGQENNVFIKWPDSNDIVWGKVW
PDLPNVNVDGSLDQESQVKLYRAYVAFPDFLRNSTAAWWKKEIGEIYSNPREPKKSLKFD
GLRIDMNEPSNFVDGSVKGCRNEILNKPPYMPYLEARDRGLSSKTLCMESEQILPDDSRV
QHYDVHSLYGWSQTRPTYEAVQEVTGERGIVITRSTFPSSGHWAGHWLGDNTAAWDQLGK
SIIGMMEFSLFGIPYTGADICGFFGDAEYEMCIRWMQLGAFYPFSRNHNNAGTRRQDPVA
WNSTFEEYSRKVLRIRYSLLPYLYTLMHKAHTEGSTVIRSLLHEFTDDNITWDIDQQFML
GPAILISPVLQSNTFKIHAYFPRARWYDHSTGSGQESMGEWRLLAAPLDHINLHVRGGYI
LPWQEPAINTYYSRKNFVGLTVALDDEGKAEGQLFWDDGQSIDTYEKGNYFLANFIATQN
TLKIQVLHNQYLSGSNQLKIGYIRLWGLNSSYVVHVAFTYNNQQFIENNFTTDPYNQKLT
IQLTEKNMNLEELTEVIWVYGDPALPTPNATSVLPTSPQPTSSSTEIVTSSALITTPDIT
STFTTTLPDITTPFPASPPITNSSDMIPFTTTTPEATTGDNTTGPTFPDITTNFPTSLHT
DVTSDIIHFTTTATETSTVDNATSTTLPPITGTTPFPQSPPVVSTSSVIPVTMTGTETGT
VGATNSTVVP
NT seq 5973 nt NT seq  +upstreamnt  +downstreamnt
atggcgagaaagctcagtgtattggaagtccttctgatcacttgcaatatagttgctttg
gcagtagacatccttttgttgcttcttgtgctggaggacccttcaggtaaggatgatggt
tcattgactcccgattgtccaaacatcgctgagtcagaaagaatagactgtgcgcccgga
caggcggtgacagaggatgtctgccgatggcagcacaaatgctgttggaagccagcggca
gatccgaaagcccctgcgtgcttcttccctaggaactggggttatgaagtcagcaatgtc
cgtacaaatacaagcacagggttgactgctcagttgaaaatattgccatctccctctctt
tttggaaatgatattgctgatgccctcttcacagctgaataccagacatccaatcgtttc
cattttaagatcacggatttcaatgagatgcgctatgaggtacctcatgagaatgccaac
ctcttgaatgggactgctgagaagtcccttttgaactactacgtagaggtcatcaataag
cccttcagcatccgaatagtgcggaagagcaacaaaagagtcttgttagacacaggcatt
gggcccctccagtttgcacagcagtacttgcagctgtctttccgactgcccagctccaat
gtgtatgggctgggggaacacgtgcaccagcaataccgtcacaacatgagctggaacacc
tggcccatcttcaccagagatgcaactcccacagagggcatggctaacctgtacggagca
cacaccttcttcttgtgccttgaagataccagtggagcttcttttggagtttttctgatg
aacagcaatgctatggaggtcactcttcagcctgctcctgccatcacttaccgtacaact
gggggcgttcttgacttttacatcttgctgggaaacacaccagagcaagtagttcaggag
tatctggaggttgttggacgaccattcttgccttcatactggagccttggtttccagctc
agccgcagggactatggtggccttgatgggttgagagaggttgtacatcgaaaccgtgat
gctcagatcccttatgatgtgcagtactcagacatagactacatggatggaaggaaagac
ttcactattgatgagcaggcttacccgcagctggcggattttgctaaggacctgcataac
aatgaacagaaatatgtaattattctgaaccctggcatcttcaaggaccttaactataag
gtctacaacaatggaagcaagagcagagtgtggatcatgagctccagtggctttgctgtt
ggggagggctatccaggacagtcagtatttcctgactttaccaatccagcctcgactctg
tggtggaccaggcagctcactgaattttatagccttctggagtttgatggtgtgtggatt
gaaatggatgaactatctacacttctccaaggtctcaatcacaagtgcgaatcaaacaac
ttgaactttcctcctttcactcccagtgtcctgaatggctcactgttggtgggaaccctc
tgcatggacacagagtttcattctggcctgcactatgatgtccacagcctgtatggctac
accatgtcaagagccacagacttggccctggaaactgtcttctcttccaagaggagcttc
atcttatcacgttctacttttgctgggtctggcaagtttgcggctcattggctgggaaac
aatgctgccacctgggatgatctccgatggtccatccccagcatccttgagtttaaccta
tttggcatccccatggtaggggcaaacatctgtggctacagaaacaatgtcacagaggaa
ctctgcagaaggtggatgcaacttggagcattttacccactgtccaggaatcacaatggt
cctacctacagggatcaggaccctgctgcctttggttctaactctctgctgttggaatcc
tcaagacattatctgaacatccgttatactttactgccctacctctacaccctcttctac
cgggctcacacatttggggagacagtagcaaggcccttggtacatgagttctatcaggac
caagccacatgggaggtgcatgaacagttcttatgggggcctggactccttatcacacct
gtgttgtatgaaggcatggaccaagtgagagcctatatcccagatgccatttggtacaac
tatgagactgaactggccatcgaatggaggaaacaattcgtagacatgtcactaccaggt
gacaggatagggcttcaccttcgaggcggctacatatttcccacccaacagccaaacaca
accacagagtccagccggaagaatcccttgggactcatcgttgccttggactacaagcga
gaagcaaagggccagttgtactgggatgatggtgtgtctaaaggcactgtgttagaaagg
aagtacattctgtatgatttttctgtgacatccaatcatttacaggcaaaaataataaat
aataattacgtggatcccaatgatctcatgttcaccgacatcagaatcttgggaatggat
aaagagccaactggtcttaatgtcttatttaataacaatgccatccccattttaagctac
aactacaatgcttcaacaaaggtgagagtgttggtcatcgataatctcacaggactgaaa
ctgggacaagaattcaccattgagtggactcttctggtcagtgacctggagaagtttaac
tgcttccccgaggatcctgcagcatctgaggaaagctgcaaacagcgcgggtgcctttgg
gagcacacaactattcctggagtgcctacctgcttctacgacaccattccccagtacgct
gccagtaacattcagtaccagcccacaggtatcaccatggacctgaccctcctggcagac
tcagcatctgcccgggcagcagcagctccaagcattgtttctgatcctctttctggaaag
atcagctctcttaaactgcatgtgacctaccatacagaaaacatgctgcaggtcaagatt
tatagttcctctaacaagagatatgaggttccaatacctctcaacatcccttcttcggcg
cttggatcctctgagaactgcctgtatgatgtcacagttaaaaccaacccatttggactt
gaaattagacggaaaaactccggtactgtgatttgggattcccaactccctggcttcacc
ttcagtgagatgtttctttccatttcaactcgccttccatctcagtacatctatggcttc
ggggaaacagagcatgaatctttcagaagaaacatgagctggaacatgtggggaatgttt
gctcgggatgaacccccagcgtacaagaagaattcctatggtgttcacccttactatatg
gcattggaagatgatggcaatgcccatggagtgctcctgttgaacagcaatgccatggat
gtgacattgcagcctaccccggccctgacataccgaaccataggagggattctggacttc
tatatggttctggggccaacacctgagcttgtaactcagcaatacacacagttgattggt
cgacccgccatgactccatactgggctttaggtttccagctgagtcgctacggataccag
agtgatgatgaaattgccaatttgtatgatgcaatggtggcagcccagattccctatgat
gtccagcatgtagacattgattacatggaccggaagttggacttcaccctcagccccagc
tttcagaatctcagtgtcctgattaatcaaatgaagacaaatggcatgaggtttattctc
attctggacccggccatttctggcaacgagacacaatatctaccatttactcgaggacaa
gaaaacaatgtgttcatcaaatggcctgactccaacgacattgtctggggcaaggtttgg
ccagatttgcccaatgtaaatgtggatggatcccttgaccaagagtctcaagttaagcta
tacagggcctatgttgcctttcctgacttcctgcgcaacagcacggctgcatggtggaag
aaagagataggggagatctattcaaatccccgggagccaaagaagagcttgaagtttgat
gggctgcggattgacatgaatgagccttcaaactttgtggatggatctgtcaagggctgc
cgcaacgaaattctcaacaagcctccctacatgccatatttggaagccagggacaggggc
ctgagcagcaagactctgtgcatggagagtgagcagatccttccagatgactcccgggtg
cagcactatgatgtgcacagcctgtatgggtggtcccagaccagacccacctatgaagct
gttcaggaggtgacaggagagagagggattgtcatcacacgctccacattcccctcttct
ggacactgggcaggacactggctgggagacaacacagctgcctgggaccagctggggaaa
tccatcattggcatgatggagttcagtctctttggaataccttatacaggagctgacatc
tgtgggttctttggagatgctgagtatgagatgtgtatccgctggatgcaactgggagca
ttttatccattttccaggaaccacaacaatgccgggactaggagacaagatcccgtggcc
tggaattcgacttttgaggagtactcaaggaaagtgttgcggatcagatactccctgctg
ccctatttatataccctgatgcataaagctcacactgagggcagcaccgtcatcagatcg
cttctccatgagttcacagacgacaatataacatgggacatagaccaacagttcatgttg
ggcccggctatcctgatcagccccgttctgcagagtaatacatttaagatccatgcttat
ttccccagagcccggtggtatgatcatagcacgggatctgggcaggaatcaatgggtgag
tggaggttactggcagcccctctggaccacatcaaccttcatgtcagaggaggctacatt
ctgccttggcaggagcctgcaataaacacctactacagtcgaaaaaattttgtgggattg
actgtagctttggatgatgaagggaaggcagaaggacagttgttttgggatgatggacaa
agcatcgatacatatgagaagggaaattatttcttagctaactttatagcaacacagaac
accctgaagatccaggtcctacataatcagtacctgagtggctcaaatcaactgaaaatt
ggatacattagactatggggtttaaattcttcttatgtggtacatgtcgcttttacctac
aacaaccagcaattcattgagaacaatttcacaactgacccctacaatcagaaactaaca
attcaattgactgaaaagaacatgaacctggaagagctgactgaggttatttgggtttat
ggagaccctgcacttcccacaccaaatgcaaccagtgtgcttcccacaagccctcagcca
acttcatctagcactgaaattgtaaccagttctgctctcataactacacctgatataaca
agtactttcacaactacacttcctgacataactacacctttccctgcaagtcctcctatt
actaactctagtgatatgattcctttcacaaccacaactcctgaagcaactactggtgac
aatacaactggccccacatttcctgatataactacaaatttccctaccagtcttcatact
gatgtcactagtgatatcattcatttcacaaccacagctactgaaacaagtactgttgac
aatgcaactagtactacacttcctccaataactggaactacacctttccctcagagtcct
cctgttgttagcactagttctgtgattcctgtcacaatgacaggtactgaaacaggcact
gtaggggctacaaactccaccgtagtgccatga

DBGET integrated database retrieval system