KEGG   Cricetulus griseus (Chinese hamster): 100769336
Entry
100769336         CDS       T02813                                 

Gene name
Slx4ip
Definition
(RefSeq) protein SLX4IP isoform X1
Organism
cge  Cricetulus griseus (Chinese hamster)
SSDB
Motif
Pfam: UPF0492 U1snRNP70_N
Other DBs
NCBI-GeneID: 100769336
NCBI-ProteinID: XP_027277476
LinkDB
Position
6
AA seq 415 aa
MASKKFAIKCGNFAVLVDLHIVPQGSNKDSSWFSEQKKEEVCLLLKETIDSRVKEYAGIY
KQHRPSNAEFTRSSPLSLKGYGFLITAYFVKRGIHLRCIQNSQNTELRIFPDRFVVCVSQ
LPFGPDTWTSQNEKSTKRTLHGVSDYFAECAESSPSPATKHKRNALQEIVRRTKAKSSAG
SKSQTSTDLVGRPSDSVIAVVPRRRASAILLSETMGPTQDDIKAAKSHRGLPVQKLENVS
QTQPEDTSSQQRPHPGEWLKTGLLSRSPVCSYESASPGPKQSPRAAKTQQKRRNCGSAEV
FDHRSRVSLGNDGLVPGDMMVEKSTAVSVLPALELSDTGLLLNQDLAKVTAKEELYALEN
LSSRHLMTNNPGLVQQTSSPAVDERLATVQGGPSKKRKKLQSSSRGCSGKKNFSV
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggcatctaagaaatttgccattaaatgtggaaattttgctgtcctcgtggatcttcat
atagtgccacaaggttcaaacaaagattccagttggttttctgaacagaagaaagaggaa
gtttgtttgctgttaaaagaaaccattgattccagagttaaggagtacgcgggcatttat
aaacagcacaggccttcaaatgcagaattcacaagatccagtcccttgtccttaaaaggt
tatggctttctcatcactgcctatttcgtcaagagggggatacaccttcgctgtattcag
aactcacagaatactgaacttcgtatatttcctgacagatttgtggtctgtgttagtcag
cttccatttggtcctgatacttggacaagccagaatgaaaagtcgacaaaaagaaccctc
catggagtgtctgactattttgctgagtgtgcagagagttctccttctcctgctacaaag
cacaagagaaatgctctacaagaaattgtgagaagaactaaagcaaaaagcagtgctggg
agcaaatcacagaccagcacagaccttgtgggaagacctagtgactcagtcattgccgtg
gtaccaaggaggagggcctcagccattctcctgtcagaaactatgggtccaacacaagat
gacataaaagcagccaagagccaccgggggcttcctgttcaaaagctggaaaatgtttct
cagactcagccagaagacactagcagccagcaacggcctcatcctggggagtggttaaag
acggggcttctaagcaggagtcctgtgtgtagctatgagtcagcatcaccaggtccaaag
caaagtccacgagcagccaagacacaacagaaacgcaggaactgtggctctgctgaagtc
tttgaccaccgcagcagagtttctcttggaaacgatggattagtcccaggagacatgatg
gtagagaagagcacagctgtcagtgttttgccagcattagagttgtcagatacagggttg
cttttgaatcaagatttggcgaaagtcacagctaaagaagagctatatgctttggaaaac
ctctcctccagacaccttatgacaaacaacccagggctggtgcagcaaactagctcgcct
gcagttgatgaaagattagctacagttcaaggcggcccaagtaaaaaaagaaagaaattg
caaagttctagcagaggatgtagtggcaagaaaaacttcagtgtatag

DBGET integrated database retrieval system