KEGG   Cricetulus griseus (Chinese hamster): 100769756
Entry
100769756         CDS       T02813                                 

Definition
(RefSeq) ras association domain-containing protein 1 isoform X2
  KO
K09850  Ras association domain-containing protein 1
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04014  Ras signaling pathway
cge04390  Hippo signaling pathway
cge04392  Hippo signaling pathway - multiple species
cge05200  Pathways in cancer
cge05206  MicroRNAs in cancer
cge05219  Bladder cancer
cge05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100769756
   04390 Hippo signaling pathway
    100769756
   04392 Hippo signaling pathway - multiple species
    100769756
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100769756
   05206 MicroRNAs in cancer
    100769756
  09162 Cancer: specific types
   05219 Bladder cancer
    100769756
   05223 Non-small cell lung cancer
    100769756
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Mst1_SARAH
Other DBs
NCBI-GeneID: 100769756
NCBI-ProteinID: XP_027270264
LinkDB
Position
4
AA seq 340 aa
MSAEPELIELRELAPSGRIGPGRTRLERANALRIAPCTARNPSQQHVPGRGHRFQPAGPA
THTWCDLCGDFIWGVVRKGLQCAHCKFTCHYRCRALVCLDCCGPRDLGWDPALERDTNVD
EPVQRETPDLSQAETEQKIKDYNGQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSK
KPPSLQDARRGPGRSTAVRRRTSFYLPKDAIKHLHVLSRTRAREVIEALLRKFMVVDDPR
KFALFERTERHGQVYFRKLSDDEQPLKLRLLAGPSEKALSFVLKENDSGEVNWDAFSMPE
LHNFLRILQREEEEHLRQILQKYSRCRQKIQEALHACPLG
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgtcggcagagccagagctcattgagctacgggagctggcaccgtctgggcgcatcggc
cccggccggacccggctggagcgtgccaacgctctgcgcatcgcgccgtgcacagcacgc
aatccctcgcagcagcacgtcccggggcgcggccaccgcttccagcctgcgggtcccgcc
acgcacacgtggtgcgacctctgtggagacttcatctggggcgtcgtgcgcaagggccta
cagtgcgcgcactgcaagttcacctgccattaccgttgtcgtgcgctcgtctgcctggac
tgctgcgggccccgagacctgggctgggatcccgcactggaaagggacacgaacgtggac
gagcctgtacagcgggagacacctgacctttctcaggctgagactgagcagaagatcaag
gattacaatggccaaatcaacagcaaccttttcatgagcctgaacaaggatggctcctac
acaggcttcatcaaggttcagctgaaactggtacgtcctgtctcagtgccttccagcaag
aaaccgccttctttacaggacgcccggcggggcccagggcggagcacagctgtgaggcgc
cgcacctccttttacttgcctaaggatgctattaagcacttgcatgttctgtcacgaaca
cgggcacgtgaggtcattgaggccctgctgcgcaagttcatggtagtggatgatcctcgc
aagtttgcgctctttgagcgaacagagcgtcatggccaagtgtacttccggaaactgtca
gatgatgagcagcccttgaagctacggcttcttgcagggcctagtgagaaggccctgagc
tttgtcttaaaagagaatgactctggggaggtgaattgggatgccttcagcatgcctgaa
ctgcacaatttcctacgcatcctgcagcgggaagaagaggaacacctccgacagatcctg
cagaagtactctcgttgccgccagaagattcaggaagccttgcacgcctgtcctttgggg
tga

DBGET integrated database retrieval system