KEGG   Cricetulus griseus (Chinese hamster): 100770033Help
Entry
100770033         CDS       T02813                                 

Gene name
Ganc
Definition
(RefSeq) glucosidase alpha, neutral C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00052  Galactose metabolism
cge00500  Starch and sucrose metabolism
cge01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100770033 (Ganc)
   00500 Starch and sucrose metabolism
    100770033 (Ganc)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100770033 (Ganc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100770033
NCBI-ProteinID: XP_007621649
LinkDB All DBs
Position
Un
AA seq 915 aa AA seqDB search
MEAAEKEEISVEDEAVDKTIFRDCSEIAFYRRQKQQLSKNTTYQALLDSVTTEQDSTRFQ
IISEANKTPLLVEVYGIEKNIFRLKINEETPLKPRYEVPDVITSKLRTVRLVSCPGDAGS
LILTDGKGDLKCHISANPFKVDLVSENEAVISINSLGQLYFEHLQIPHKQSRATKGNQES
APADTSQENQEDLGLWEEKFGKFVDVKANGPSSIGLDFSFHGFEHLYGIPQHAESHQLKN
TRDGDAYRLYNLDVYGYQIHDKMGIYGSVPYLLAHKQGKTVAIFWLNASETLVEINTEPA
VEYTLTQTGAAAAKQKVRCRTDVRWMSESGIIDVFLLTGPTPSDIFKQYSSLTGTQAMPP
LFSLGYHQCRWNYEDEQDVKAVDAGFDEHGIPYDVMWLDIEHTEDKKYFTWDKKRFANPR
RMQELLRSKKRKLVVISDPHIKVDPDYSVYAKAKEQGFFVKNPEGGDFEGVCWPGLSSYL
DFTNPKVREWYSGLFAFPVYQGSTDILFIWNDMNEPSVFRGPELTMQKNAVHYGNWEHRE
LHNMYGFYQQMATAEGLIRRSKGQERPFVLSRSFFAGSQKYGAVWTGDNAAEWNYLKISI
PMLLTLSVSGISFCGADVGGFIGNPETELLVRWYQAGAYQPFFRGHATMNTKRREPWLFG
EEYTRLIREAIRERYTLLPYLYSLFYRVHMSSEPVMRPLWVEFPDDLETFSVDDEYMLGS
ALLVHPITEPQTTMADIFLPGSNEVWYDSKTFAQWKGGCTVKIPVTLDTIPVFQRGGSVV
PIKTSVGKSTGWMTDSPYGLRLALSTQDSAEGELYLDDGHSFQYLHQDQFLHRRFSFCSG
VLINRCADEKGHYPSKCIVEQILVLGLRKKPSSVTTRSSDGKVQPAAFTYHTKASALSLE
KLSLSITDDWEVHIR
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagctgagaaagaggaaatcagtgttgaagatgaagctgtggataaaaccatt
ttcagagactgtagtgagattgctttctacaggcggcagaaacagcagctctccaagaat
accacctatcaggcattgttagactcagtcacaacagaacaggacagcaccaggttccaa
atcatcagtgaagcaaataagactcctctcctggttgaagtttatggcatagagaaaaac
attttcagacttaaaattaatgaagaaactccactgaaaccaaggtatgaggttcctgac
gtcatcaccagcaagctaagaactgtaaggctggtctcatgcccaggggatgctggcagc
ctgatactgacagatggcaaaggagatctgaagtgtcacatctcagcaaacccattcaag
gtagacttggtgtctgagaacgaggctgtgatcagcatcaactccctgggccagttatac
tttgagcacctacagattcctcacaagcaaagcagagctaccaaagggaaccaggagagc
gcaccagccgacacctctcaggaaaatcaagaagacctaggcctgtgggaagagaaattt
ggaaaatttgtggatgtcaaagctaatggtccttcctctattggtttggatttctccttt
catggatttgaacatctctatggtatccctcaacatgcagaatcacaccaacttaaaaac
actagggatggagatgcataccgcctttataacctagatgtctatggatatcaaatacat
gacaaaatgggcatttatggttcagtgccttatctcctggcgcacaaacagggcaagact
gtagccattttctggctaaatgcctcggaaacactagtggagatcaacacagagccagca
gttgagtacacgctaacccagacgggcgctgcagctgccaaacaaaaggtcaggtgtcga
actgatgtgcgctggatgtcagagagtggaatcattgatgtttttctgctgacaggacct
acaccttctgacatcttcaagcagtactcatccctcacaggcacacaagccatgccccct
cttttttccctggggtaccaccagtgccgctggaactatgaagatgagcaggatgtgaag
gcagtggatgcaggttttgatgagcatggcattccatatgacgtcatgtggctggacata
gagcacactgaggacaagaaatacttcacctgggacaaaaagaggttcgcaaaccccaga
agaatgcaagagctactcaggagcaaaaaacgcaagcttgtggttatcagtgacccccac
atcaaggtggatcctgactactcagtctatgccaaagccaaagaacagggcttctttgtg
aagaatccagaaggtggcgactttgaaggagtatgttggcctggtctctcatcttacctg
gatttcaccaatcccaaggtcagagagtggtattccggcctttttgcttttcctgtgtat
cagggatctacagacatcctcttcatatggaatgacatgaatgagccctcagtcttcaga
gggccagagctaaccatgcaaaagaatgctgttcattatggcaattgggagcacagggaa
cttcacaacatgtatggattttatcagcaaatggctactgcagaaggactgatacggcga
tctaaagggcaggagagaccctttgttctttcacgttctttctttgctggatcacaaaag
tatggtgcagtatggacaggagacaatgcagcagaatggaactatctgaaaatttccatc
ccaatgttactcaccctcagtgtctccgggatctctttctgtggagctgatgtgggtggc
ttcattggcaatccagagacagagctgctggtgcgttggtaccaggctggagcttaccag
ccctttttccgtggccacgctaccatgaacaccaagcgtcgagaaccctggctgtttggg
gaagaatacactcggctgatccgggaagctatcagagagcgctacaccctcctaccctat
ctgtattctctgttttaccgtgtgcacatgtcttctgaacctgttatgaggcctctgtgg
gtcgagttccctgatgacttagagactttcagtgtggatgatgaatacatgctgggaagt
gctttattggttcatccaatcacagagccacagaccaccatggctgatatattcctgcca
gggtcaaatgaggtctggtatgactctaagacatttgcacagtggaaaggagggtgcact
gtgaagattccagtaaccttggatactataccagtgtttcaacgaggcggaagtgtggta
ccaataaagaccagtgtgggcaagtccacaggctggatgactgactccccatatggactc
cggcttgctctaagcactcaggactctgctgagggagagctgtatcttgatgacggccat
tcattccagtacctccaccaggaccagttcttacaccgcaggttttcattctgttccggt
gttctgatcaacaggtgtgctgatgagaagggtcattatcccagcaagtgcatagtggag
caaatcttggtcttaggccttaggaagaagccatcttctgtgactacccgctcatctgat
ggtaaggttcagcctgcagcttttacataccacactaaagcatcggccctaagtctggag
aagctttccctcagcattaccgatgactgggaggtccatatcagatga

DBGET integrated database retrieval system