KEGG   Cricetulus griseus (Chinese hamster): 100770120
Entry
100770120         CDS       T02813                                 

Gene name
Mdm2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2 isoform X3
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01522  Endocrine resistance
cge01524  Platinum drug resistance
cge04068  FoxO signaling pathway
cge04110  Cell cycle
cge04115  p53 signaling pathway
cge04120  Ubiquitin mediated proteolysis
cge04144  Endocytosis
cge04151  PI3K-Akt signaling pathway
cge04218  Cellular senescence
cge04625  C-type lectin receptor signaling pathway
cge04919  Thyroid hormone signaling pathway
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05169  Epstein-Barr virus infection
cge05200  Pathways in cancer
cge05202  Transcriptional misregulation in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cge00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100770120 (Mdm2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100770120 (Mdm2)
   04151 PI3K-Akt signaling pathway
    100770120 (Mdm2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100770120 (Mdm2)
  09143 Cell growth and death
   04110 Cell cycle
    100770120 (Mdm2)
   04115 p53 signaling pathway
    100770120 (Mdm2)
   04218 Cellular senescence
    100770120 (Mdm2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100770120 (Mdm2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100770120 (Mdm2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100770120 (Mdm2)
   05202 Transcriptional misregulation in cancer
    100770120 (Mdm2)
   05206 MicroRNAs in cancer
    100770120 (Mdm2)
   05205 Proteoglycans in cancer
    100770120 (Mdm2)
   05203 Viral carcinogenesis
    100770120 (Mdm2)
  09162 Cancer: specific types
   05214 Glioma
    100770120 (Mdm2)
   05220 Chronic myeloid leukemia
    100770120 (Mdm2)
   05218 Melanoma
    100770120 (Mdm2)
   05219 Bladder cancer
    100770120 (Mdm2)
   05215 Prostate cancer
    100770120 (Mdm2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100770120 (Mdm2)
   05169 Epstein-Barr virus infection
    100770120 (Mdm2)
   05165 Human papillomavirus infection
    100770120 (Mdm2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100770120 (Mdm2)
   01522 Endocrine resistance
    100770120 (Mdm2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    100770120 (Mdm2)
   04121 Ubiquitin system [BR:cge04121]
    100770120 (Mdm2)
Enzymes [BR:cge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100770120 (Mdm2)
Membrane trafficking [BR:cge04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    100770120 (Mdm2)
Ubiquitin system [BR:cge04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    100770120 (Mdm2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP DUF4194 zf-FPG_IleRS
Other DBs
NCBI-GeneID: 100770120
NCBI-ProteinID: XP_027248139
LinkDB
Position
1
AA seq 511 aa
MSSCVLASGEGTPGTSPATTTEPLLRGSRPMCNTSMSVSTDGAESTSQIPASEQETLVRP
KPLFLKLLKSVGAQKDTYTMKEIIFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPS
FSVKDHRKIHIMIYRNLVVVSQQESSDSGTSVSESRCQPEGDSEQKDPVQEPQEEKPSSD
SVSRPSTSSRRRTISETEENADELPGDRQRKRHRSLSFDESLALCVLREICCERSSSSES
TEPPSNQDLDDGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDYSQSEGGQELSDEDDEV
YRVTVYQSGESDVDSFEGDPEISLADYWKCTSCNEMNPPLPPHCNRCWTLRENWLPEDKG
KDKGDMPEEAKLEAEGLDVPDGKKATANDCKESCTEESDDKEIYTSQSQESEDYSQPSTS
SSIVYSSQEDVKEWEKEETPDKEESVESGFSLNAIEPCVICQGRPKNGCIVHGKTGHLMS
CFPCAKKLKKRNKPCPVCRQPIQMIVLTYFS
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgagcagctgtgtgctggcgagcggagaggggacacctgggacctccccggccacgacg
acggagcctctcctgcgtggatcgaggccaatgtgcaataccagcatgtctgtgtctact
gatggtgccgaaagcacctcacagattccagcttcggaacaagagactctggttagacca
aaaccattgtttctgaagttgttaaagtctgtcggtgcacaaaaagatacctatactatg
aaagagattatattttatcttggccagtatattatgactaaacgattatatgatgagaag
cagcaacatattgtgtattgttcaaatgatcttttaggagatttgtttggagtgccaagc
ttctctgtgaaagaccacaggaaaatacatataatgatctacagaaacttggtggtcgta
agtcagcaagagtcttcagactcaggcacatcagtgagtgagagcagatgtcagcctgaa
ggtgacagtgaacagaaggaccccgtgcaagagccacaagaagagaagccttcttcagat
tcagtttctagaccgtctacctcatctagaaggagaacaattagtgagacagaagaaaac
gcagatgagctacctggtgatcgacagaggaagcgccacaggtccctttcctttgatgaa
agcctggctttgtgtgtgttacgagagatatgctgtgaaagaagcagcagcagcgagtcc
acagagcccccctcaaatcaggatcttgacgatggtgtaagtgaacactcaggtgactgg
ttggatcaggattcggtttccgatcaattcagtgtagaatttgaagttgagtctcttgac
tcagaagattacagccagagtgaaggagggcaggagctctcagatgaggatgatgaggtc
tatcgagtcacagtgtatcaatcaggagaaagtgatgtagactcctttgagggagatcct
gaaatctcattagctgactattggaaatgtacctcctgcaatgaaatgaatcctcccctt
ccacctcactgcaacagatgttggacccttcgtgagaattggcttccggaagataaaggg
aaggataaaggggacatgcctgaagaagccaaactggaggcagaaggcttagatgtgcct
gatgggaaaaaagctacagcgaatgattgtaaggagtcctgcactgaggaaagtgatgat
aaggaaatatatacctcccagtcacaagagagtgaggactattcccagccgtcaacgtcc
agcagcattgtttatagcagccaggaagatgtcaaagagtgggagaaggaagagacacca
gacaaagaagagagtgtggaatctggcttctctcttaatgccattgaaccatgtgtgatt
tgccaagggcggcctaaaaatggttgcattgttcatggcaaaactggacatctcatgtca
tgtttcccatgtgcaaagaagctaaaaaaaaggaataagccctgcccagtgtgcagacaa
ccaattcaaatgattgtgctaacttattttagctag

DBGET integrated database retrieval system