KEGG   Cricetulus griseus (Chinese hamster): 100770550
Entry
100770550         CDS       T02813                                 

Gene name
Psen1
Definition
(RefSeq) presenilin-1
  KO
K04505  presenilin 1 [EC:3.4.23.-]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04310  Wnt signaling pathway
cge04330  Notch signaling pathway
cge04722  Neurotrophin signaling pathway
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100770550 (Psen1)
   04330 Notch signaling pathway
    100770550 (Psen1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100770550 (Psen1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100770550 (Psen1)
   05022 Pathways of neurodegeneration - multiple diseases
    100770550 (Psen1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100770550 (Psen1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cge01002]
    100770550 (Psen1)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.-  
     100770550 (Psen1)
Peptidases and inhibitors [BR:cge01002]
 Aspartic peptidases
  Family A22: presenilin family
   100770550 (Psen1)
SSDB
Motif
Pfam: Presenilin VIT1
Other DBs
NCBI-GeneID: 100770550
NCBI-ProteinID: XP_027274253
UniProt: G3HNF2
LinkDB
Position
5
AA seq 467 aa
MTEIPAPLSYFQNAQMSEDSHSSSTVRSQSDSQDRQQHHDRRRLDNPEPVSNGRPQSHSR
QVVEQDEEEDEELTLKYGAKHVIMLFVPVTLCMVVVVATIKSVSFYTRKDGQLIYTPFTE
DTETVGQRALHSILNAAIMISVIVVMTILLVVLYKYRCYKVIHAWLIVSSLLLLFFFSFI
YLGEVFKTYNVAVDYITVALLIWNFGVVGMIAIHWKGPLRLQQAYLIMISALMALVFIKY
LPEWTAWLILAVISVYDLVAVLCPKGPLRMLVETAQERNETLFPALIYSSTMVWLVNMAE
GDPEAQRRVPKNPKYNAQRAERERQDSSTGNDDGGFSEEWEAQRDSHLGPHRSTPESRAA
VQELSSSILTNEDPEERGVKLGLGDFIFYSVLVGKASATASGDWNTTIACFVAILIGLCL
TLLLLAIFKKALPALPISITFGLVFYFATDYLVQPFMDQLAFHQFYI
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgacagagatacctgcgcccttgtcctacttccagaatgcccagatgtctgaggacagc
cactccagcagcaccgtccgtagccagagcgacagtcaggaccggcagcagcaccatgac
aggcggagacttgacaaccctgagccagtatctaatggtcgaccccagagtcactcacgg
caggtggtggaacaagatgaggaagaagatgaagagctgacattgaaatatggagccaag
catgtcatcatgctctttgttcccgtgaccctctgcatggtggtagttgtggctaccatc
aaatcagtcagcttttatacccggaaagatggacagctaatctataccccatttacagaa
gacactgaaactgtaggccaaagagccctgcactcgattctgaatgcggccatcatgatc
agtgtcattgttgtcatgaccatcctcctggtggttctttataaatacaggtgctacaag
gtcatccatgcctggcttattgtttcatctctgttgttgctgttctttttttcattcatt
tacttgggggaagtgtttaagacctacaatgttgctgtggactacattacagttgcactc
ctgatctggaactttggtgtggtggggatgattgccattcactggaaaggcccacttcga
ctgcagcaggcgtatctcattatgatcagtgccctgatggccctggtctttatcaagtac
ctccctgaatggaccgcatggctcatcttggctgtaatttcagtatatgatttggtggct
gttttgtgccccaaaggtccacttcgtatgctggttgaaacagctcaagaaagaaacgaa
actctctttccagctctgatctattcctcaacaatggtatggttggtgaatatggctgaa
ggagacccagaagcccaaagaagggtacccaaaaaccccaagtacaatgcacaaagagca
gagagggagagacaggactctagtactgggaacgatgatggtggcttcagtgaggagtgg
gaagcccagagggacagtcacctggggcctcatcgctccactcctgagtcaagagctgct
gtccaggaactttccagcagtatcctaaccaatgaagacccggaggaaaggggagtaaaa
ctcggattgggagatttcattttctacagtgttctggttggtaaagcttcagcaaccgcc
agtggagactggaacacaaccatagcctgctttgtagccatattaattggcctgtgcctt
acgttactactactcgccatcttcaagaaggcgctgccagctctccccatctccatcacc
tttgggctggttttctactttgccacagactatctcgtgcagccctttatggaccagctt
gcattccatcaattttacatctaa

DBGET integrated database retrieval system