KEGG   Cricetulus griseus (Chinese hamster): 100770628Help
Entry
100770628         CDS       T02813                                 

Gene name
Gys2
Definition
(RefSeq) glycogen [starch] synthase, liver isoform X1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00500  Starch and sucrose metabolism
cge01100  Metabolic pathways
cge04151  PI3K-Akt signaling pathway
cge04152  AMPK signaling pathway
cge04910  Insulin signaling pathway
cge04922  Glucagon signaling pathway
cge04931  Insulin resistance
Module
cge_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100770628 (Gys2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100770628 (Gys2)
   04152 AMPK signaling pathway
    100770628 (Gys2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100770628 (Gys2)
   04922 Glucagon signaling pathway
    100770628 (Gys2)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    100770628 (Gys2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cge01003]
    100770628 (Gys2)
Enzymes [BR:cge01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     100770628 (Gys2)
Glycosyltransferases [BR:cge01003]
 Polysaccharide
  Storage polysaccharide
   100770628 (Gys2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 100770628
NCBI-ProteinID: XP_027285970
LinkDB All DBs
Position
8
AA seq 706 aa AA seqDB search
MLRGRSLSVTSLSGLPVWEAERLPVEDILLFEVSWEVTNKVGGIYTVIQTKAKTTADEWG
ENYFLIGPYFEHNMKTQVEQCEPINDAVRKAMDAMNKHGCQVYFGRWLIEGSPYVVLFDI
SSSAWNLDRWKGDFWEACGVGIPHHDREANDMLIFGSLTAWFLKEVTDHADGKHVIAQFH
EWQAGTGLVLSRARKLPISTIFTTHATLLGRYLCAANIDFYNQLDKFNIDKEAGERQIYH
RYCMERASVHCAHVFATVSGITAIEAEHMLKRKPDVVTPNGLNVKKFSAVHEFQNLHVMY
KARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRLNFLLRMHKSNV
TVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTAHAMKEKFGKKLYDGLLRGEIPDMNSIL
DRDDITIMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNNRADRVKVILHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQE
HVADPTAYGIYIVDRRFRSPDDSCNQLTQFLYGFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRYYQHARHLSLSRAFPDKFHLEPTSPPTTDGFKYPRPPSVPPSPSGSQTSSPQSSEGE
DDGDGDDDERYDEEEEAERDRLNIKSPFLLNHVPKGKKKLHGEYKN
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgctcagaggccggtccttgtccgtgacttccctgagtgggctccctgtgtgggaagcc
gaaagactccctgtggaagacatactgctttttgaagtttcttgggaggtgaccaacaaa
gttgggggcatctatactgtgattcagaccaaggccaaaacaacagcagatgaatgggga
gaaaactactttctgataggtccctactttgagcataatatgaagactcaggtagaacag
tgtgagcccatcaatgatgctgtcagaaaagccatggatgcaatgaataaacatggctgc
caggtgtattttggaagatggctgatagaagggagtccatacgtggtgctttttgacata
agctcttcagcatggaacctggacaggtggaagggtgacttctgggaggcttgtggcgtt
ggcatccctcatcacgaccgagaagccaacgacatgctcatatttgggtctctaactgcc
tggttcttaaaagaggtgacagaccatgcagatggtaaacatgtcattgcccaattccat
gaatggcaggctggaactgggctagtcctttctcgtgccaggaaactccccatctccaca
atatttacaacccatgccacactgcttgggcggtatctctgtgcagcaaatattgacttc
tacaaccagctcgacaagttcaacatagacaaagaggcgggggagaggcagatttatcac
cgctactgcatggagcgggcttcggtgcactgcgcgcacgtgttcgccacggtgtccgga
atcacagccatcgaggcggagcacatgctgaagcggaagcctgatgtagtgactccaaat
ggcttgaatgttaagaagttttctgcagtgcatgaatttcaaaatctccatgttatgtac
aaggccagaatccaagattttgttcgaggtcatttctatggtcatttggattttgatctt
gagaagactttgttccttttcatcgctgggaggtatgagttctcaaacaagggagctgac
atcttcctggaatccttatccaggctcaatttcctcctgaggatgcataagagtaacgtc
accgtggtggtgtttttcatcatgcctgccaagacaaacaatttcaacgtggagaccttg
aagggccaggcggtgcggaaacagctgtgggacactgcacatgctatgaaggaaaagttt
ggaaagaaactctacgacgggttactgagaggagaaattcctgacatgaatagtatcttg
gatcgagatgacataacaattatgaaaagagccattttttcaactcagagacagtctttg
cctcctgtcaccactcacaacatgatcgatgactccacggatcccatcctcagcaccatc
agacggatcgggcttttcaacaatcgagcagacagagtcaaggtgattttacacccagaa
tttctgtcctccaccagccccctgctacccatggattatgaagagtttgtccggggttgt
catcttggggtatttccatcgtactatgaaccctggggttacactccagccgaatgcacg
gtgatgggcatcccgagtgtgacaacaaacctctcaggctttgggtgtttcatgcaggag
catgtggcagaccctacagcatatggtatttacatagtcgacaggcgcttccgatctcca
gatgactcttgcaatcagctgactcagtttctctacgggttttgcaaacagtcacgccgc
cagaggatcatccagaggaaccgcacggagaggctctcagatcttctggactggagatac
ctaggcaggtattaccagcatgccagacacctgagtctaagcagagcttttccagacaaa
ttccatctggagcccacctcacctccaacgacggatgggtttaagtatcccaggcccccg
tcagtaccaccttcgccatccggatctcagacctccagtcctcagagcagtgaaggggaa
gatgacggagacggggatgacgacgaaaggtacgatgaggaagaggaggcggagagggat
cggttaaatatcaagtcaccctttctcctgaaccacgttccaaaggggaagaagaagctt
catggggaatacaagaactga

DBGET integrated database retrieval system