KEGG   Cricetulus griseus (Chinese hamster): 100770737
Entry
100770737         CDS       T02813                                 

Gene name
Smad4
Definition
(RefSeq) mothers against decapentaplegic homolog 4 isoform X2
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04068  FoxO signaling pathway
cge04110  Cell cycle
cge04310  Wnt signaling pathway
cge04350  TGF-beta signaling pathway
cge04371  Apelin signaling pathway
cge04390  Hippo signaling pathway
cge04520  Adherens junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04659  Th17 cell differentiation
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge05161  Hepatitis B
cge05166  Human T-cell leukemia virus 1 infection
cge05200  Pathways in cancer
cge05210  Colorectal cancer
cge05212  Pancreatic cancer
cge05220  Chronic myeloid leukemia
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100770737 (Smad4)
   04350 TGF-beta signaling pathway
    100770737 (Smad4)
   04390 Hippo signaling pathway
    100770737 (Smad4)
   04371 Apelin signaling pathway
    100770737 (Smad4)
   04068 FoxO signaling pathway
    100770737 (Smad4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100770737 (Smad4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100770737 (Smad4)
   04550 Signaling pathways regulating pluripotency of stem cells
    100770737 (Smad4)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100770737 (Smad4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100770737 (Smad4)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100770737 (Smad4)
   05212 Pancreatic cancer
    100770737 (Smad4)
   05225 Hepatocellular carcinoma
    100770737 (Smad4)
   05226 Gastric cancer
    100770737 (Smad4)
   05220 Chronic myeloid leukemia
    100770737 (Smad4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100770737 (Smad4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100770737 (Smad4)
   05161 Hepatitis B
    100770737 (Smad4)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 100770737
NCBI-ProteinID: XP_027253671
LinkDB
Position
2
AA seq 552 aa
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPPSMLVKDEYVHDFEGQPSLPTEGHSIQ
TIQHPPSNRASTETYSAPALLAPSESNATSTTNFPNIPVASTSQPASILAGSHSEGLLQI
ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH
YWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGD
RFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR
APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAP
AISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVL
HTMPIADPQPLD
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggacaatatgtctataacaaatacaccgacaagcaatgacgcctgtctgagcattgta
catagtttgatgtgtcatagacaaggtggagaaagtgaaacgtttgcaaaaagagcaatt
gaaagtttggtaaagaagctgaaagagaaaaaagatgaattggattctttaataacagct
ataactacaaatggagctcatcctagcaaatgtgtcaccatacagagaacactggatgga
cggcttcaggtggctggtcggaaaggctttcctcatgtcatctatgcccgtctatggagg
tggcctgatctacacaagaatgaactaaaacatgttaaatattgtcagtatgcatttgat
ttaaaatgtgatagtgtctgtgtgaatccatatcactatgaacgagttgtttcacctgga
attgatctctcaggattaacactgcagagtaatgctccaccaagtatgttagtgaaggat
gaatacgttcatgactttgagggacagccatccttacccactgaaggacattcaattcaa
accatccaacatccaccaagtaatcgtgcatcgacggagacatacagcgccccagctctg
ttagccccatctgagtctaatgctactagtaccaccaacttccccaacattcctgtggct
tccacaagtcagccggccagtattctggcaggcagccatagtgaaggactgttgcagata
gcttcagggcctcagccaggacagcagcagaacggatttactggtcagccagctacttac
catcataacagcactaccacctggactggaagtaggactgcaccatacacacctaatttg
cctcaccaccaaaacggccatcttcagcaccacccgcctatgccgccccatcctggacat
tactggccagttcacaatgagcttgcattccagcctcccatttccaatcatcctgctcct
gagtattggtgttccattgcttactttgaaatggatgttcaagtaggagagacatttaag
gttccttcaagctgccctattgttactgtggatggatacgtggatccctctggaggagat
cgcttttgcttgggtcaactctccaatgtccacaggacagaagctattgagagagcaagg
ttgcacataggcaaaggtgtgcagctggaatgcaaaggtgaaggtgatgtttgggtcaga
tgccttagtgaccatgcagtctttgtgcagagttactacctggacagagaagctggacga
gcacctggagacgctgttcataagatctacccaagtgcatatataaaggtctttgatttg
cggcagtgtcatcggcagatgcagcagcaggcagccactgcacaagctgcagctgctgca
caggcagcagctgtagcaggaaacatccctggtcctggatccgtaggtggaatagctcca
gcaatcagtctgtctgctgctgccggcatcggtgtcgatgacctccgtcgcttgtgcata
ctcaggatgagctttgtgaaaggctggggccccgattacccaagacagagcatcaaggaa
acaccatgctggatcgaaattcacctccaccgtgctctccagctccttgatgaagtgctt
cacaccatgcccattgcagacccgcaacctttagactga

DBGET integrated database retrieval system