KEGG   Cricetulus griseus (Chinese hamster): 100771005Help
Entry
100771005         CDS       T02813                                 

Gene name
Dot1l
Definition
(RefSeq) DOT1 like histone lysine methyltransferase
  KO
K11427  histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00310  Lysine degradation
cge05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100771005 (Dot1l)
 09160 Human Diseases
  09161 Cancers
   05202 Transcriptional misregulation in cancers
    100771005 (Dot1l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cge03036]
    100771005 (Dot1l)
Enzymes [BR:cge01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100771005 (Dot1l)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100771005 (Dot1l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1 HALZ
Motif
Other DBs
NCBI-GeneID: 100771005
NCBI-ProteinID: XP_016822427
LinkDB All DBs
Position
5
AA seq 1768 aa AA seqDB search
MGLCRTCQHLLCLQGEQSSESVPSCGESGVQALGVCISEQEGVSLCACWGLTLQGFLFQD
KHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQL
WKGTTQPMKLNTRPSNGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMI
DEIKMTEDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKW
YGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVS
SKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSS
MKNPKLKEEQEAARRRQQRENKSNATTPTKVSENKAAATEAPVDSGAEEEKSGVATVKKP
SPSKARKKKLNKKGRKMAGRKRGRPKKMSAVNAERKSKKSQSALDLLRSPPAAPPSASPQ
DAYRAPHSPFYQLPPSTQLHSPNPLLVAPTPPALQKLLESFKIQYLQFLAYTKTPQYKAN
LQQLLDQEKEKNTQLLGTAQQLFGHCQAQKEEIRRLFQQKLDELGVKALTYNDLIQAQKE
ISAHNQQLREQSEQLEKDNSELRSQSLRLLRARCEELRLDWSTLSLENLRKEKQALRSQI
SEKQRHCLELQISIVELEKSQRQQELLQLKSCVPPDDALSLHLRGKGTLSRELEADAGRL
RLELDCAKISLPHLSSMSPELSMNGHVTGYELCNAASRPSSKQNTPQYLASPLDQEVVPC
TPSHSGRPRLEKLSGLALPDYTRLSPAKIVLRRHLSQDHTGASKAAASEPHPRAEHAKES
TLPYQSPGLSNSMKLSPQDPLPASPASSPLTSEKGSEKGVKERAYSSHGETITSLPVSIP
LSTVQPNKLPVSIPLASVVLPSRAERARSTPSPVPQSRDASSTLEKQIGASTHGAGGSAA
GSRSLALAPTGFYAGSVAISGALANSPAPLASGMESAVFDESSGTSSLFAIMGSRSTPPQ
HPPLLPQPRNSGPASPAHQLSASPRLSVTTQGPLLDTSKGELPSDPAFSDPESEAKRRIV
FSIAASSSSKQSPSTRHSPLTSSTRGDCVQSHGQDSRKRSKRKRASAGTPSLSTGVSPKR
RALPTVAGLFTQSSGSPLNLNSMVSNINQPLEITAISSPESSLKSSPTPYQDHDQPPVLR
KERPLGPTNGAHYSPLTSDEEPGSEDEPSSARIERKIATISLESKSPPKTLENGGSLVGR
KSAPSSEPVNSSKWKSTFSPISDLSLAKAVDSPLQAGSALSHSPLFSFRPALEEPAAEAK
LPTHPRKSFAGSLAAAEGPSPGANPPNGLAFSGGLAADLGLHSFNDGASLSHKGPEVASL
SASVSFPSQRGKDSTTDANPFLSRRQPEGLGGLKGEGSAGKEPGETLPLCGPADKVALPH
GSRASKGRDRELDFKGGHNLFISAAAVPPGGLLGGPGLVTVASSAGSVTPAAQAPRPFLS
TFNPGPQFTLGPMSLQANLGSVAGSSVLQSLFSTVPAAAGLVHVSSTATRLTNSHTMGSF
SSGVAGGTVGGVFTHAVPSASAHPFGAGVGSGAVCSSATLGLSPLQAAASTSASSFQAAA
SVETRPPPPPPLLPPQHLGRPPAGPPVLHAPPPPNVALPPPPALLAANSEPVLLQSLASL
PANKAFLPPSSAASLQPANASLSVKLASLPHKVSRPSFTVHHQPLPRLALAQAAPATPQA
SSSGPSAVWVSLGMPPPYAAHVSGVKPR
NT seq 5307 nt NT seq  +upstreamnt  +downstreamnt
atgggactctgcaggacttgccaacacctgttgtgtttgcagggggaacaaagctctgag
tcagtccccagctgtggggaatctggggtccaggccctgggagtgtgcatctcagaacaa
gagggggtgtcactgtgtgcttgctggggactgactctgcagggttttctctttcaggac
aagcaccacgatgctgctcatgagattattgagactatccggtgggtctgtgaggaaatc
ccggatctcaagctggccatggagaactacgtcctgatcgactatgataccaaaagtttt
gaaagcatgcagaggctgtgtgacaagtacaaccgagccatcgacagtatccaccagctg
tggaagggcaccacacagcccatgaagctaaacactcggccatctaatggactcctgcgg
cacatcctgcagcaggtgtacaaccactctgtaactgaccccgagaagctcaacaactat
gagcccttctcccctgaggtgtacggggagacctcctttgacctggttgcccagatgatt
gacgagatcaagatgaccgaggatgacctgtttgtagacctgggcagtggtgtggggcag
gttgtccttcaggttgctgcggccaccaactgcaaacatcactacggagtggagaaagcg
gacatcccggccaagtacgcggagaccatggaccgagagttcaggaagtggatgaaatgg
tatggaaaaaagcatgcagaatacacactggaacgaggtgacttcctctcagaggagtgg
agggagcggatcgccaacacgagtgttatatttgtgaataactttgcctttggtcctgag
gtggatcaccaactgaaggagcgattcgcaaacatgaaggaaggtggcagaatcgtttcc
tcaaagccctttgcccctctcaacttcaggatcaacagcaggaatttgagtgacattggc
accatcatgcgtgtggtagagctgtcgcccctgaagggctccgtgtcatggactgggaag
cctgtctcctactacctgcacactatcgaccggaccatacttgaaaactatttttctagt
atgaaaaatccaaaactcaaggaggaacaggaggcagctcggcgccggcaacagcgagag
aacaagagcaatgcaactactcccaccaaggtctcagagaacaaggcagctgccaccgag
gcgcctgtggactctggtgctgaggaagaaaagtcaggtgtggccactgtcaaaaagcca
tcaccctccaaagcccggaagaagaagctaaacaagaaagggaggaagatggctgggcgg
aagcgggggcggcccaagaaaatgagtgctgtgaacgctgagcgcaagtcgaagaagagc
caaagtgcactggacctcctgcgctcccctcccgcagccccaccctcagcctcaccccag
gatgcatacagggcacctcatagcccgttctaccagctacctccgagcacgcagctccac
tctcccaatccactgctggtggcgcccaccccgcctgcgttacagaagcttttagagtcc
ttcaaaatccagtacctgcagttcctggcgtacacgaaaaccccacaatacaaggccaac
ctgcagcagcttctggaccaggagaaggagaagaacacacagctgctgggcactgcacag
cagctcttcggtcattgccaggcccaaaaggaggagatccgaagactgttccagcagaag
ctggatgagttgggcgtgaaggctctgacctacaatgacctgattcaggcccagaaggag
atctctgcccacaaccagcagctgcgggagcagtcggaacagctggagaaggacaacagc
gagctgcggagccagagcctgcggctgctcagggcccgatgtgaggagctgaggctggat
tggtccacattgtctctggagaacctgcggaaagagaagcaggccctgcggagccagatc
tcagagaagcagcgacactgcctggagctgcagatcagcattgtggagctggagaagagc
cagcgacagcaggagctcctgcagttgaagtcctgtgtaccaccagatgacgctctgtcc
ctgcatctgcgtggcaagggtaccctgagccgagagctggaggctgatgctgggcggttg
cgtcttgagctggactgtgccaagatctccctgccacacctcagcagcatgagccctgag
ctctccatgaatggccatgtcactggctacgagctctgcaatgcagctagtcggccctca
tccaaacagaacaccccccagtacctggcctcccccttggaccaggaggtagtaccctgc
acccccagccacagtggccggcctcggctagaaaagttgtctggcctggctttgccagac
tacacccggttgtcaccagccaagattgtgttgaggcggcacctgagccaggaccacact
ggggctagcaaagcagctgccagtgagccacaccctcgggcggagcacgccaaggagagc
acccttccctaccagagccctggcttgtccaacagcatgaagctcagcccccaagaccca
ctgcctgcctccccggcgtcctcaccactcacctcagagaagggcagtgagaagggtgtg
aaggagcgtgcctacagtagccacggggagactatcaccagcctgcctgttagcattcca
ctcagcactgtgcagcccaacaagctgcctgtcagcatcccactggccagcgtggtgcta
cccagccgcgccgagagggcgaggagcacgcccagccctgtgccacagtctcgagatgcc
tcatccacacttgaaaagcagatcggtgcttccacccatggtgcagggggcagtgcagca
gggagcaggagcctcgccttggcacccacaggcttctatgctggctcagtggccatcagt
ggggcgttggccaacagcccagctcctctggcctcggggatggaatcagctgttttcgac
gagtcctctggcaccagcagcctctttgccatcatggggtctcgcagcacaccaccacag
cacccacctctgctgccgcagcctcgaaactccggccctgcctctcctgcacaccaactc
tcagccagtccccgcctgagtgtgaccacccagggtccactgctggacaccagcaaaggg
gagctgccctctgaccctgccttctcagacccggagagtgaagctaagaggagaattgtg
ttcagcattgcagccagctccagctcgaagcagtcgccttccactaggcacagccccttg
acctccagcacccgtggggactgtgtacagagccatgggcaggacagtcgtaagcgcagc
aaaaggaagcgtgcgtcagctggaactcccagcctcagcacaggtgtgtccccgaagcgc
cgggctctgccgactgtcgctggcctcttcacgcagtcctcggggtctcccctcaacctc
aactccatggtcagcaacatcaatcagcccctggagatcacagccatctcgtcccctgag
agctccctcaagagctcccccactccctaccaggaccatgatcagcccccagtgctcagg
aaggagcggcccctgggcccgaccaatggggcccattactcaccactgacctcagatgag
gagccaggctctgaagatgagcccagcagtgcccgaattgagagaaaaattgcaacaatc
tccttagaaagtaaatctcccccgaagacgctggaaaatggtggtagcttggtgggaagg
aagtctgccccctcaagtgagcctgtgaacagcagcaaatggaagtccaccttctcaccc
atctctgacctcagcttggccaaggccgtggacagtccgctacaggctggctctgcgctg
agccacagccccctgttctctttccggccagctctggaggagcctgctgctgaggccaag
ctccccacccacccaaggaagagtttcgctggctctctggctgcagctgagggcccgagc
cctggcgccaatcctcccaatggtctggccttcagtgggggcctcgctgcagacctcggt
ttacacagcttcaatgatggtgcttccctctcccacaagggccctgaagtggccagcctg
agcgcctctgtgagcttcccatcacagcggggcaaggacagtaccacagacgccaacccc
ttcctcagcaggcggcagccagagggtctgggtggcctgaagggcgagggcagtgcaggc
aaggagcccggcgagacccttcccctgtgcgggcctgcagacaaggttgcgttgcctcat
ggcagcagggccagcaagggtcgtgaccgggagctggacttcaagggcggccacaacctc
ttcatctctgctgcagctgtgcctccaggtggcctcctgggtggccctggccttgtaact
gtggcttcctctgcgggcagtgtgacacctgctgcccaggctccccggcccttcctgagt
accttcaaccctgggccccagttcactctgggccccatgtccctgcaggccaacctgggc
tctgtggctggctcctccgtgctgcagtccttgttcagcactgtgccagctgctgcaggc
ttggtgcatgtatcatccactgcgacccgactgaccaactcacacaccatgggcagcttc
tcctccggggtggccggcggaactgttggaggtgtctttacccatgcggtgccttctgcc
tctgctcacccgtttggagctggtgtcggcagcggggctgtgtgtagcagtgccacgctg
ggcctgagcccgctgcaggcggcggccagcacctcggcttcttcctttcaggccgcggct
tcggttgagactaggccgccccctccacctcccctgcttcctcctcagcacctgggccgg
ccccctgcggggccacctgtcctccacgcaccccctcctcctaacgttgccttgcctcct
ccgcctgcgctgctggccgctaactcagagccggtgcttctgcagagcctggcctccctc
cccgctaacaaagctttcttacccccctcctctgccgcctctctgcagcctgctaacgcc
tctctgtctgtcaagctcgcctccctcccacacaaggtctcccgcccctccttcacggtg
caccaccagcccctgccccggctggccctggcgcaggccgcgcccgccaccccgcaggcc
agctcctcggggccatctgctgtgtgggtttcccttggcatgccgcctccttatgccgcg
cacgtttcgggggttaagcctcgataa

DBGET integrated database retrieval system