KEGG   Cricetulus griseus (Chinese hamster): 100771077
Entry
100771077         CDS       T02813                                 

Gene name
Ptpn11
Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 11 isoform X2
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04014  Ras signaling pathway
cge04072  Phospholipase D signaling pathway
cge04360  Axon guidance
cge04625  C-type lectin receptor signaling pathway
cge04630  JAK-STAT signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04670  Leukocyte transendothelial migration
cge04722  Neurotrophin signaling pathway
cge04920  Adipocytokine signaling pathway
cge04931  Insulin resistance
cge05168  Herpes simplex virus 1 infection
cge05205  Proteoglycans in cancer
cge05211  Renal cell carcinoma
cge05220  Chronic myeloid leukemia
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100771077 (Ptpn11)
   04630 JAK-STAT signaling pathway
    100771077 (Ptpn11)
   04072 Phospholipase D signaling pathway
    100771077 (Ptpn11)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100771077 (Ptpn11)
   04650 Natural killer cell mediated cytotoxicity
    100771077 (Ptpn11)
   04670 Leukocyte transendothelial migration
    100771077 (Ptpn11)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100771077 (Ptpn11)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100771077 (Ptpn11)
  09158 Development and regeneration
   04360 Axon guidance
    100771077 (Ptpn11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100771077 (Ptpn11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100771077 (Ptpn11)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100771077 (Ptpn11)
   05211 Renal cell carcinoma
    100771077 (Ptpn11)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100771077 (Ptpn11)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100771077 (Ptpn11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cge01009]
    100771077 (Ptpn11)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100771077 (Ptpn11)
Protein phosphatases and associated proteins [BR:cge01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    100771077 (Ptpn11)
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 PTPlike_phytase Tab2_like
Other DBs
NCBI-GeneID: 100771077
NCBI-ProteinID: XP_027269913
LinkDB
Position
4
AA seq 597 aa
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG
DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGK
EAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYD
VGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETT
DKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEP
VSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEV
ERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRELKLSKVGQALLQGNTERTVW
QYHFRTWPDHGVPSDPGGVLDFLEEVHHKQESIMDAGPVVVHCSAGIGRTGTFIVIDILI
DIIREKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSK
RKGHEYTNIKYSLVDQTSGDQSPLPPCTPTPPCAEMREDSARVYENVGLMQQQRSFR
NT seq 1794 nt   +upstreamnt  +downstreamnt
atgacatcgcggagatggtttcaccccaacatcactggtgtggaggcagagaatctcctg
ctgaccagaggagtggatggcagttttttggcaaggcccagtaagagtaaccctggagac
ttcactctgtctgttagaagaaatggagccgtcacccacatcaagattcagaacactggg
gactactatgacctctatggtggggagaagtttgccaccttggctgaactggtccagtat
tatatggagcatcatgggcagctgaaagagaagaatggagatgttattgagctcaagtac
ccactgaattgtgcggacccgacctctgaaaggtggttccatggtcacttgtctggaaaa
gaagcagagaaattgctaacggagaagggtaagcatggcagcttccttgtccgagagagc
cagagccaccctggagacttcgttctctctgtccgtaccggtgatgacaaaggggagagc
aatgatggcaagtccaaagtgacccacgtcatgatccgatgtcaggaactgaaatacgac
gttggcggaggagagcgctttgactctttgacagacctggtggagcattacaagaagaac
cctatggtggagactctgggcacagtcctgcagctcaagcagcctctcaacacaactcgt
attaatgctgctgaaatcgaaagccgggttcgagagctaagcaagttagctgagaccaca
gataaagtcaaacagggcttttgggaagaatttgagactctacagcaacaggaatgcaaa
cttctctacagccgaaaagaaggacagagacaagaaaataaaaacaaaaatagatacaaa
aatatcctgccttttgatcacactagggtcgtcctacacgatggggatcccaacgagccc
gtttctgattacatcaatgcaaacatcatcatgcctgaattcgaaaccaagtgcaacaat
tcaaaacccaaaaagagttacattgccactcaaggctgcctgcagaacacagtaaatgac
ttctggaggatggtgttccaggagaactctcgagtcatcgtcatgactacaaaggaggtg
gaaagagggaagagcaaatgcgtcaagtactggcctgatgagtatgcactcaaagaatat
ggggtcatgcgtgttaggaatgtcaaagaaagtgccgctcatgactacaccttaagagaa
ctcaaactctccaaggtcggacaagctctactccagggaaatacagagagaaccgtctgg
cagtaccattttcggacctggccggatcatggtgtgcccagtgaccctggaggtgtgctg
gacttcctggaagaggtccaccacaagcaggagagcatcatggacgcaggccctgtcgtg
gttcactgcagtgctggaattggccggacaggaacattcattgttattgacattcttatt
gacatcattagagagaaaggtgtggactgtgacattgatgttcctaaaaccattcagatg
gtgcggtcccagaggtcagggatggtccagacagaagcacagtacaggttcatctacatg
gccgtccagcattatatcgagacgctgcagcgcaggattgaggaggagcagaaaagcaaa
aggaaaggacatgagtataccaatattaagtattccctggtggaccagacaagcggcgat
caaagtcccctgccaccttgtaccccaacaccaccctgtgcagaaatgagggaggacagc
gcacgagtgtacgagaatgtgggcctcatgcagcagcagaggagcttcagatga

DBGET integrated database retrieval system