KEGG   Cricetulus griseus (Chinese hamster): 100771626
Entry
100771626         CDS       T02813                                 

Gene name
Gab2
Definition
(RefSeq) GRB2-associated-binding protein 2 isoform X3
  KO
K08091  GRB2-associated-binding protein 2
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04014  Ras signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04380  Osteoclast differentiation
cge04664  Fc epsilon RI signaling pathway
cge04666  Fc gamma R-mediated phagocytosis
cge05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100771626 (Gab2)
   04072 Phospholipase D signaling pathway
    100771626 (Gab2)
   04071 Sphingolipid signaling pathway
    100771626 (Gab2)
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    100771626 (Gab2)
   04666 Fc gamma R-mediated phagocytosis
    100771626 (Gab2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100771626 (Gab2)
 09160 Human Diseases
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100771626 (Gab2)
Domain-containing proteins not elsewhere classified [BR:cge04990]
 Pleckstrin homology (PH) domain-containing proteins
  Grb-2 associated binder (Gab) family proteins
   100771626 (Gab2)
SSDB
Motif
Pfam: PH PH_11 PH_9 PH_3 PH_2 PH_8
Other DBs
NCBI-GeneID: 100771626
NCBI-ProteinID: XP_027263474
LinkDB
Position
3
AA seq 663 aa
MSGGDDVVCTGWLRKSPPEKKLRRYAWKKRWFILRSGRMSGDPDVLEYYKNEHSKKPLRI
INLNFCEQVDAGLTFNKKELQDSFVFDIKTSERTFYLVAETEADMNKWVQSICQICGFNQ
AEESTDSLRNLSSVSHGPRSSPAEFSSSSQHLLRERKSSAPSHSSQPTLFTFEPPVSSHI
QPALSTSAPQEYLYLHQCISRRTENARSASFSQGTRQKSDTAVQKLAQGNGHCINGVSGQ
VHGFYSLPKPSRHNTEFKDSTYDLPRSLASHSHTKGSLTGSETDNEEVYTFKTPSNTLCR
EFGDLLVDNMDVPTTPLSAYQIPRTFTLDKNHNAMTVATPGDSAIAPPPRPPKPSQAETP
RWGSPQQRPPVSENSRSVATTIPRRNTLPAMDNSRLHRASSCETYEYPTRGGESASWSAE
SPGKTIVGRSDSASSDDNYVPMNPGSSTLLAMERAGDNSQSVYIPMSPGPHHFDPLGYPS
TALPIHRGPSRGSEIQPPPVNRNLKPDRKAKPTPLDLRNNAVIDELPFKSPVTKSWSRVN
HTFNSSSSQYCRPISTQSITSTDSGDSEENYVPMQNPVSASPVPSGTNSPAPKKSTGSVD
YLALDFQPGSPSPHRKPSTSSVTSDEKVDYVQVDKEKTQALQNTMQEWTDVRQSSEPSKG
AKL
NT seq 1992 nt   +upstreamnt  +downstreamnt
atgagcggcggcgacgacgtggtgtgcaccggctggctgaggaaatcgcctcccgagaag
aagttgaggcgctatgcctggaagaaacgctggtttatcctgcggagcggccggatgagt
ggcgacccagatgttctggaatactacaagaatgaacactccaagaaacccctgcggatc
atcaacctgaacttctgtgagcaggtggatgcaggcctgaccttcaacaagaaagagctt
caagatagttttgtgtttgatatcaagaccagtgagcgcactttttacctggtggctgag
acagaagccgacatgaataagtgggtccagagcatctgccagatctgcggcttcaatcag
gctgaggagagcacagactctctgagaaacctttcttcggtcagtcatggtccccgctct
tctccagctgagttcagcagctccagtcagcacctgctccgagaaaggaagtcctcagcc
ccttcacactctagccagcccacgttattcacatttgagccccctgtgtcaagccacatc
cagcctgccttgtctaccagtgcacctcaggagtatctctacttgcaccagtgcataagc
cgaaggacagaaaatgcaaggagtgccagcttctctcagggcacccggcagaagagtgat
acagccgtgcaaaaacttgcccagggcaatggacactgtatcaacggagtcagcggtcaa
gtccatggcttctatagccttcccaagccaagccgacacaatacagaattcaaagacagt
acttatgacctcccccgtagcctggcttcacacagccacaccaagggcagcctcacaggg
tctgagacagataatgaggaagtgtacaccttcaagacacccagcaataccctgtgtcgg
gagtttggagacctcctagtggacaatatggatgttccaaccacccctctctcagcctac
cagattcctagaacattcacactggacaagaaccacaatgccatgacagtggccactcct
ggagactcagccatagctcccccaccccggccccccaagccaagtcaggcagaaacacct
cggtggggcagccctcagcaaagacctccagttagtgaaaatagcagatctgtagctact
actatccccaggcgcaacaccctccctgcaatggacaacagccgactccaccgagcttct
tcctgtgagacctacgagtacccaacacgaggtggagagagcgccagctggtctgctgaa
tctccagggaagactatcgtgggtcgatcagacagtgccagctctgatgacaactacgtg
cccatgaacccaggatcttctaccctgctggctatggaacgagcaggggacaattcccaa
agtgtctacatccccatgagcccagggccccatcactttgacccactaggctacccatcc
acagcccttcctattcatagaggccccagccgaggaagtgagatccagccacccccagtc
aatcgcaatctcaagcctgaccgcaaagcaaagccaacacctcttgacctgagaaacaat
gctgtcatcgatgagctccctttcaagtcacctgtcaccaagtcttggtccagggtcaac
cacacctttaactccagctcctcccagtactgccgtcctatctccacacaaagcatcacc
agcacagactccggagacagcgaggagaactatgtccctatgcaaaacccagtgtctgca
tcccctgttcccagtggcaccaacagcccagctccgaagaagagtactggcagcgtggac
tacctagccctagacttccagccgggctccccgagccctcaccgaaagccatccacatca
tctgtcacatcggatgagaaagtagactatgtccaagtggataaagagaagacccaggcc
ctgcagaacaccatgcaggagtggacagatgtgcggcaatcctcagaaccttccaagggt
gccaagctgtga

DBGET integrated database retrieval system