KEGG   Cricetulus griseus (Chinese hamster): 100773301
Entry
100773301         CDS       T02813                                 

Gene name
Myc
Definition
(RefSeq) myc proto-oncogene protein isoform X2
  KO
K04377  Myc proto-oncogene protein
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04110  Cell cycle
cge04151  PI3K-Akt signaling pathway
cge04218  Cellular senescence
cge04310  Wnt signaling pathway
cge04350  TGF-beta signaling pathway
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04630  JAK-STAT signaling pathway
cge04919  Thyroid hormone signaling pathway
cge05132  Salmonella infection
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05169  Epstein-Barr virus infection
cge05200  Pathways in cancer
cge05202  Transcriptional misregulation in cancer
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05213  Endometrial cancer
cge05216  Thyroid cancer
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05222  Small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100773301 (Myc)
   04012 ErbB signaling pathway
    100773301 (Myc)
   04310 Wnt signaling pathway
    100773301 (Myc)
   04350 TGF-beta signaling pathway
    100773301 (Myc)
   04390 Hippo signaling pathway
    100773301 (Myc)
   04630 JAK-STAT signaling pathway
    100773301 (Myc)
   04151 PI3K-Akt signaling pathway
    100773301 (Myc)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100773301 (Myc)
   04218 Cellular senescence
    100773301 (Myc)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100773301 (Myc)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100773301 (Myc)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100773301 (Myc)
   05202 Transcriptional misregulation in cancer
    100773301 (Myc)
   05206 MicroRNAs in cancer
    100773301 (Myc)
   05205 Proteoglycans in cancer
    100773301 (Myc)
   05230 Central carbon metabolism in cancer
    100773301 (Myc)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100773301 (Myc)
   05225 Hepatocellular carcinoma
    100773301 (Myc)
   05226 Gastric cancer
    100773301 (Myc)
   05216 Thyroid cancer
    100773301 (Myc)
   05221 Acute myeloid leukemia
    100773301 (Myc)
   05220 Chronic myeloid leukemia
    100773301 (Myc)
   05219 Bladder cancer
    100773301 (Myc)
   05213 Endometrial cancer
    100773301 (Myc)
   05224 Breast cancer
    100773301 (Myc)
   05222 Small cell lung cancer
    100773301 (Myc)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100773301 (Myc)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100773301 (Myc)
   05161 Hepatitis B
    100773301 (Myc)
   05160 Hepatitis C
    100773301 (Myc)
   05163 Human cytomegalovirus infection
    100773301 (Myc)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100773301 (Myc)
   05169 Epstein-Barr virus infection
    100773301 (Myc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cge03000]
    100773301 (Myc)
   03019 Messenger RNA biogenesis [BR:cge03019]
    100773301 (Myc)
Transcription factors [BR:cge03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    100773301 (Myc)
Messenger RNA biogenesis [BR:cge03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100773301 (Myc)
SSDB
Motif
Pfam: Myc_N HLH Myc-LZ
Other DBs
NCBI-GeneID: 100773301
NCBI-ProteinID: XP_027287374
UniProt: G3IP28
LinkDB
Position
10
AA seq 447 aa
MPLNVSFSNRNYDLDYDSVQPYFICDEEENFYHHQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVTVAASFSPREDDDGGGGGGGGGGNFSTADQLEMVTELLGGDMVSQ
SFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSASPSPARGHGGCSS
TSSLYLQDLTAAASECIDPSVVFPYPLSDSSSPKSCTSSDSTAFSPSSDSLLSSESSPRA
SPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQPSARRSESGSSPSGGHSKPPHS
PLVLKRCHVSTHQHNYAAPPSTRKDYPPAAKRAKLDSGRVLKQISNNRKCASPRSSDTEE
NDKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSIQAEERK
LISEKDLLRKRREQLKHKLEQLRNSVA
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgcccctcaacgtgagcttctccaacaggaactatgacctcgactacgactcggtgcag
ccctatttcatctgcgacgaggaggagaatttctatcaccaccagcagcagagcgagctg
cagccgcccgcgcccagtgaggatatctggaagaaatttgagctgctgcccaccccgccc
ctgtcccccagccgccgctcggggctctgctctccatcctatgtgacggtcgctgcgtcc
ttctccccgagggaggacgacgacggcggcggcggcggcggcggcggcggtggcaacttc
tccaccgcggatcagctggagatggtgaccgagctgctgggaggagacatggtgagtcag
agcttcatctgcgaccctgacgacgagaccttcatcaagaacatcatcatccaggattgt
atgtggagcggcttctcggccgccgccaagctggtctccgagaagctggcttcctaccag
gctgcgcgcaaagacagcgccagcccgagccccgcccgcgggcacggaggctgctcctcc
acctccagcctgtacctgcaggatctcaccgccgccgcgtccgagtgcatcgacccctct
gtggtctttccctacccgctcagcgacagcagctcgcccaagtcctgtacctcgtccgac
tccacagccttctctccttcctcggactcgctgctgtcctcggagtcctcccctcgggcc
agcccggagcccctggtgctgcacgaggagacacctcccactaccagcagcgactctgag
gaagaacaagaagatgaggaagaaattgatgtcgtgtctgtggaaaagaggcagccctct
gctaggaggtccgaatcagggtcatccccatccggaggccacagcaaacccccacacagc
ccgctggttctcaaaagatgccacgtctccactcatcagcacaattacgcagcgcccccc
tccacgaggaaggactatcctccagctgccaagagggccaagttggacagtggcagggtc
ctgaaacagatcagcaacaaccgcaaatgtgccagccccagatcctcagacacagaggag
aacgacaagaggaggacacacaacgtcttggaacgccagaggagaaacgagctgaagcgc
agcttttttgcccttcgtgaccagatcccggagttggaaaacaatgaaaaggcccccaag
gtagttatcctcaaaaaagccaccgcctacatcctgtccatccaagccgaagaacgcaag
ctcatctcagaaaaggacttactgaggaagcggagagaacagttgaaacacaaactcgaa
cagcttcgaaactctgttgcgtga

DBGET integrated database retrieval system