KEGG   Cricetulus griseus (Chinese hamster): 100773307
Entry
100773307         CDS       T02813                                 

Gene name
Ctnnb1
Definition
(RefSeq) catenin beta-1
  KO
K02105  catenin beta 1
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04015  Rap1 signaling pathway
cge04310  Wnt signaling pathway
cge04390  Hippo signaling pathway
cge04510  Focal adhesion
cge04520  Adherens junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04670  Leukocyte transendothelial migration
cge04916  Melanogenesis
cge04919  Thyroid hormone signaling pathway
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05100  Bacterial invasion of epithelial cells
cge05132  Salmonella infection
cge05160  Hepatitis C
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05210  Colorectal cancer
cge05213  Endometrial cancer
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05412  Arrhythmogenic right ventricular cardiomyopathy
cge05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100773307 (Ctnnb1)
   04310 Wnt signaling pathway
    100773307 (Ctnnb1)
   04390 Hippo signaling pathway
    100773307 (Ctnnb1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100773307 (Ctnnb1)
   04520 Adherens junction
    100773307 (Ctnnb1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100773307 (Ctnnb1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100773307 (Ctnnb1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100773307 (Ctnnb1)
   04916 Melanogenesis
    100773307 (Ctnnb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100773307 (Ctnnb1)
   05205 Proteoglycans in cancer
    100773307 (Ctnnb1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100773307 (Ctnnb1)
   05225 Hepatocellular carcinoma
    100773307 (Ctnnb1)
   05226 Gastric cancer
    100773307 (Ctnnb1)
   05216 Thyroid cancer
    100773307 (Ctnnb1)
   05217 Basal cell carcinoma
    100773307 (Ctnnb1)
   05215 Prostate cancer
    100773307 (Ctnnb1)
   05213 Endometrial cancer
    100773307 (Ctnnb1)
   05224 Breast cancer
    100773307 (Ctnnb1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100773307 (Ctnnb1)
   05022 Pathways of neurodegeneration - multiple diseases
    100773307 (Ctnnb1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100773307 (Ctnnb1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100773307 (Ctnnb1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100773307 (Ctnnb1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100773307 (Ctnnb1)
   05100 Bacterial invasion of epithelial cells
    100773307 (Ctnnb1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100773307 (Ctnnb1)
   05163 Human cytomegalovirus infection
    100773307 (Ctnnb1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100773307 (Ctnnb1)
   05165 Human papillomavirus infection
    100773307 (Ctnnb1)
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 100773307
NCBI-ProteinID: XP_027271222
UniProt: G3H996
LinkDB
Position
4
AA seq 781 aa
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTS
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEALGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggctactcaagctgatctaatggagttggacatggccatggagccggacagaaaagct
gctgttagtcactggcagcagcagtcatacttggattctggaatccattctggtgccacc
accacagctccttctctgagtggcaagggcaaccctgaggaagaagatgtggacacctcc
caagtcctgtatgagtgggagcaaggtttttcccagtccttcactcaagagcaagtggcg
gatattgacggacagtacgccatgactcgggctcagagggtgcgagctgccatgttccct
gagaccctagatgagggtatgcagatcccgtccacacagtttgacgcggctcatcccacc
aacgtccagcgcctggctgagccatcccagatgctgaagcatgccgttgttaatttgatt
aactatcaggatgacgcggaacttgccacacgtgcaattcccgagctgacaaaactgcta
aatgatgaggaccaggtggtagttaataaagctgctgttatggttcatcagctttccaaa
aaggaagcttccagacatgccatcatgcgctctcctcagatggtgtctgctattgtacgc
accatgcagaacacaaatgatgtagaaacagctcgttgtactgctgggaccttacacaac
ctttctcaccaccgtgagggcttgctggccatctttaaatctggaggcattcctgctctg
gtgaaaatgcttgggtcaccagtggattctgttctgttctatgccatcacgacgctgcac
aacctcctgctacatcaggaaggagctaaaatggcggtgcgcctagccggtggactgcaa
aaaatggttgctttgctcaacaaaacaaacgtgaaattcttggctattacaacagactgc
ctgcagatcttagcttatggcaatcaagagagcaagctgatcatcctggccagtggtgga
ccccaggccttagtaaatataatgaggacctatacttatgagaagcttctgtggaccaca
agcagagtgctgaaggtgctatctgtctgctccagcaacaagccagccattgtggaagct
ggtgggatgcaggcactaggacttcacctgacagatccgagtcagcgacttgttcagaac
tgtctttggactcttagaaacctttcagatgctgcaactaaacaggaagggatggaaggt
ctccttgggactctagtgcagcttctgggttcagatgatataaatgtggtcacctgtgca
gctggaattctttctaacctcacttgcaataattacaagaacaagatgatggtgtgccaa
gtgggtggcatagaggctcttgtgcgcactgtccttcgtgctggtgacagggaggacatt
actgagcctgccatctgtgctcttcgtcatctgaccagccgacatcaggaagctgagatg
gcccagaatgccgttcgccttcactatggactacctgttgtggttaaactcctgcaccca
ccatcccactggcctctgataaaggcgactgttggattgattcgaaaccttgccctttgc
ccagcaaatcatgcaccgttgcgggagcagggcgctattccacgactagttcagttgctt
gttcgagcccatcaggacacccagcggcgtacctccatgggtgggacacagcagcagttt
gtggagggcgtccgcatggaggagatagtggaaggctgtaccggggccctgcatatcctc
gctcgcgatgttcacaaccgcatcgtaatccgaggactcaacaccattccactgtttgtg
cagttgctttattctcccattgaaaatatccaaagagtagctgcaggggtcctttgtgaa
cttgctcaggacaaggaggctgcagaggccatagaagctgagggagccacggctcccctg
acagagttacttcactccaggaacgaaggcgtggcaacttatgcagctgctgtcttattc
cggatgtctgaggacaagccacaggattacaagaaacggctttcagtagagctgaccagt
tctctcttcaggacagagccaatggcttggaatgagactgctgatcttggcctggacatt
ggtgcccagggagaagcccttggatatcgccaggacgatcccagctaccgttcctttcac
tctggtggatacggccaggatgccttggggatggaccctatgatggagcatgagatgggt
ggccaccaccctggtgctgattatccagttgatgggctgccagacctggggcatgcccag
gacctcatggacgggctgcccccaggtgacagcaatcagctggcctggtttgacactgac
ctgtaa

DBGET integrated database retrieval system