KEGG   Cricetulus griseus (Chinese hamster): 100773594
Entry
100773594         CDS       T02813                                 

Gene name
Cacna1e
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X2
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04010  MAPK signaling pathway
cge04020  Calcium signaling pathway
cge04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100773594 (Cacna1e)
   04020 Calcium signaling pathway
    100773594 (Cacna1e)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100773594 (Cacna1e)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cge04040]
    100773594 (Cacna1e)
Ion channels [BR:cge04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100773594 (Cacna1e)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 100773594
NCBI-ProteinID: XP_027273873
LinkDB
Position
5
AA seq 2272 aa
MARFGEAVVVGRPGSGDGDSDQSRNRQGTPVPASGPAAAYKQSKAQRARTMALYNPIPVR
QNCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTP
MSRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTH
FNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIG
LEFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECKDWIGPNDGITQFDNILFAV
LTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERE
RVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNAGTSALEVLRRATIKRSR
TEAMTRDSSDEHCVDISSVGTPLARASIKSTKVDGASYFRHKERLLRISIRHMVKSQVFY
WIVLSVVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSS
FNCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSS
MKSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDW
NEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEE
EEAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWE
QRTSQLRRHMQMSSQEALNKEEAPPMNPLNPLNPLSPLNPLNAHPSLYRRPRPIEGLALG
LGLEKCEEERISRGGSLKGDIGGLTSALDNQRSPLSLGKREPPWLPRSCHGNCDPTQQEA
GGGETVVTFEDRARHRQSQRRSRHRRVRTEGKESASVSRSRSASQERSLDEGVSIEGEKE
HEPQGSHRSKEPTIHEEERTQDLRRTNSLMVPRGSGLVGVLDEAETPLVQAQPELEVGKD
AALTEQEAEGSSEQALLGDVQLDVGRGISQSEPDLSCMTANMDKGTTESTSVTVAIPDVD
PLVDSTVVHISNKTDGEASPLKEAETKEEEEEVEKKKQKKEKRETGKAMVPHSSMFIFST
TNPIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFT
FEMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALANALGTNKGRDIKTIKSLR
VLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYC
TDSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVL
QHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECS
LEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMK
YYSAPCTYELALKYLNIAFTMVFSLECVLKVIAFGFLNYFRDTWNIFDFITVIGSITEII
LTDSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLF
FIYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGC
EPDTTAPSGQNESERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGP
HHLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVA
EDMTVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKTLDLLVPMP
KASDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKAL
PYLQQDPVSGLSGRSGYPSMSPLSPQEIFQLACMDPADDGQFQEQQSLVVTDPSSMRRSF
STIRDKRSNSSWLEEFSMERSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGR
ERGRSKERKHLLSPDVSRCNSEERGTQADWESPERQQSRSPSEGRSQTPNRQGTGSLSES
SIPSVSDTSTPRRSRRQLPPVPPKPRPLLSYSSLMRHTGGISPPPDGSEGGSPLASQALE
SNSACLTESSNSLHPQQGQHSSPQHYISEPYLALHEDSHASDCGEEETLTFEAAVATSLG
RSNTIGSAPPLRHSWQMPNGHYRRRRRGGPGPGMMCGAVSDLLSDTEEDDKC
NT seq 6819 nt   +upstreamnt  +downstreamnt
atggctcgcttcggggaggcggtggtcgttggcaggccgggctcaggcgatggagactcg
gaccagagcaggaaccggcaaggaacccctgtaccggcctcggggccagcagctgcctac
aagcagtcgaaagctcagagggcgcggactatggctttgtacaaccccatccctgtccgg
cagaactgtttcaccgtcaacagatccctgttcatcttcggagaagataacattgtcagg
aaatacgccaagaagctcatcgattggccgccatttgagtacatgatcctggccaccatc
attgccaactgcatcgtcctggccctggagcagcaccttcctgaggatgacaagaccccg
atgtcccgaaggctggaaaagacagaaccatatttcattggaattttctgctttgaagct
gggatcaaaattgtagctctagggttcatcttccataagggttcatacctccgaaatggc
tggaatgtcatggacttcattgtggtcctcagtggcatcctggccactgcaggaacccac
ttcaacacccatgtggacctgcggaccctccgggctgtgcgtgtcttgaggcccttaaag
ctcgtgtcaggaatacctagcctacagattgtgttgaagtctatcatgaaggccatggtg
cctcttctgcagattggccttctgctcttctttgccatccttatgttcgctatcattggc
ttggagttctacagtggcaagttacatcgagcatgcttcatgaacaattcaggtattcta
gagggattcgatcctccccacccatgtggtgtgcagggctgcccagctggttacgaatgt
aaggactggattggccccaatgacgggatcacccaatttgacaacatcctttttgctgtg
ctgactgtcttccaatgcatcacaatggaagggtggaccactgtgctgtacaataccaat
gatgccttaggagccacctggaattggctgtacttcatccccctcatcatcattggatcc
ttttttgttctcaaccttgtcctgggagtgctttcaggggaatttgccaaagaaagagag
agagtggagaaccgaagagcattcatgaagcttcggcggcagcaacagattgagcgagag
ttgaatggctaccgtgcctggatagacaaagcagaggaagtcatgcttgctgaagaaaat
aaaaacgctggaacatcagccttggaagtgcttcgaagggcaaccatcaaaaggagccgg
acggaggccatgacccgagactccagcgatgagcactgcgttgatatctcttctgtgggc
acacctcttgccagagccagtatcaagagcacaaaggtagatggagcctcctatttccgg
cacaaggaacggcttctacgtatctctatccgccacatggtcaaatcccaagtgttttac
tggatcgtcctgagtgttgtggctctcaatactgcctgtgtggccattgttcatcacaac
cagccccagtggctcactcacctcctctactatgcagaatttttgtttctgggacttttc
ctgttggagatgtccctgaagatgtatggcatggggccacgcctttattttcactcttca
ttcaactgctttgattttggggtcacagtgggcagcatctttgaggtggtctgggcaatc
ttcagacctggtacatcttttggaatcagcgtcttacgagctctccggctcctaaggata
tttaaaataaccaagtattgggcatccctccggaatcttgttgtctccttgatgagctcc
atgaagtccattatcagtttgctcttcctcctcttcctcttcatcgttgtcttcgctctc
ctaggaatgcagctctttggaggcaggtttaactttaatgatgggactccttcggctaat
tttgacaccttccctgcagctatcatgacagtgtttcagatcctgacaggggaagattgg
aatgaggtgatgtacaatggcatccgctcccagggtggggtcagctcaggcatgtggtct
gccatctacttcattgtgctcaccttgtttggaaactacacactgctgaatgtattcttg
gccatcgctgtggacaatctggccaatgcccaggaattgaccaaggatgaacaggaggag
gaagaagctttcaaccagaaacatgcactgcagaaggccaaggaggttagcccgatgtct
gcacccaacatgccttctattgaaagagacagaaggagaagacaccacatgtcgatgtgg
gagccgcgcagcagccacctgagggagcggaggcgccggcaccacatgtctgtgtgggaa
caacgcaccagccagctgaggaggcacatgcaaatgtctagccaagaagccctcaacaaa
gaggaggccccaccgatgaaccccctcaatccactcaatccactgagccctctcaaccca
ctcaacgctcaccccagcctctaccggaggcccaggcccattgagggtctagcccttggt
ctgggtctcgagaagtgtgaagaggagcgcattagccgaggtggttccctcaagggtgat
atagggggcctgactagtgccctggacaaccagaggagccccttgtccttaggcaaacgg
gagccaccttggctgcccagatcctgtcatggaaactgtgatccaacccagcaggaggct
gggggaggagagacagtggtgacttttgaggaccgggccaggcataggcagagccagcga
cgcagccgccatcgccgtgttaggactgagggcaaggagtcggcctccgtctcccgaagc
aggtcggccagccaggagcggagtctggatgaaggggtatccattgagggggagaaagaa
catgagcctcagggcagccacaggagcaaggagccaaccatccatgaagaggagagaacc
caagacttaaggaggaccaacagtctgatggtacccaggggctctggactggtaggagtt
cttgatgaggcagaaactcctctcgtccaagcccaacctgagttggaagtggggaaggat
gcagctctgacagagcaggaggctgaaggcagcagcgagcaagccctgcttggggacgta
cagctggatgtgggccggggcattagccagagcgagcctgacctctcttgcatgacagcc
aacatggacaagggtaccactgagagcaccagcgtcacggtcgccatccctgatgttgac
cccttggtggattcaacagtggtgcacattagcaacaagactgatggagaagccagtccc
ttgaaggaggcagagaccaaagaggaagaagaagaggtggagaagaagaagcagaagaag
gagaagcgagagactggcaaagccatggtgccccatagctctatgttcatcttcagcacc
actaacccgatccgcagggcctgccactacattgtgaacctacgctattttgagatgtgc
atcctcctggtgattgcagccagcagcattgccctggcagccgaggaccctgtcctgacc
aattcggagcgcaacaaagtcctgagatatttcgactatgttttcacaggcgtgtttacc
tttgagatggttataaagatgatagaccaaggattgatcctgcaggatggatcctacttc
cgagatctctggaacatcctggactttgtggtagtggttggtgcattggtagcctttgct
ctggcgaacgctttgggaaccaacaagggtcgggacatcaagactatcaagtctctgagg
gtactccgagttctgcgaccactgaaaaccatcaagcgcttgcccaagctgaaggctgtg
tttgactgcgtagtgacttccttgaagaacgtcttcaacatactcattgtctacaagctc
ttcatgttcatcttcgctgtcatcgctgttcagctattcaagggaaagttcttttattgc
accgacagttcaaaggacacagagaaggagtgcataggcaactatgtagatcatgagaaa
aacaagatggaggtaaagggccgggaatggaagcgtcatgaattccactatgacaacatc
atctgggccctgctgaccctcttcactgtctccacaggggaagggtggcctcaggtcctg
cagcattctgtagatgtgacagaggaggatagaggcccaagccgcagcaaccgcatggag
atgtctatcttttatgtggtctactttgttgtgttccctttcttcttcgtcaatattttt
gtggctctcatcatcatcaccttccaggagcaaggggataagatgatggaggagtgtagc
ctggaaaagaatgagcgggcatgcattgacttcgccattagtgcaaaacccctcacccgc
tacatgccgcagaacaggcacaccttccagtaccgagtgtggcacttcgtggtctctcca
tcctttgaatataccatcatggccatgatcgccttgaacactgttgtactgatgatgaag
tactattctgctccttgcacctatgaacttgccctaaagtacctgaacattgccttcacc
atggtgttttccctggaatgtgtcctaaaggtcatcgcttttggcttcctgaactatttc
cgagatacctggaacatctttgacttcatcacagtgattggcagtatcacagaaattatc
ctgacagacagcaagctggtgaacaccagtggcttcaatatgagctttctgaagctcttc
cgagctgcgcgcctcataaagctcctgcggcagggctacaccatacgcattttactgtgg
acctttgtgcaatcctttaaggctcttccctatgtctgccttctgattgctatgcttttc
ttcatctatgccatcatcgggatgcaggtatttggaaacataaaattagatgaggaaagt
cacatcaaccgacacaacaacttccggagtttcttcgggtccctcatgctgctcttcagg
agtgccacaggggaggcttggcaggagataatgctgtcctgtctcggcgagaagggctgt
gagcctgataccactgcaccctctgggcagaacgagagtgagcgctgtggcactgacctg
gcctacgtttactttgtctccttcatcttcttctgctcctttctgatgctcaacctgttc
gtggctgtcatcatggacaactttgagtacctgactcgagattcttctatcctggggcct
caccacttggatgagtttgtccgtgtctgggcagaatatgacagagcagcatgtggccgc
atccattacactgagatgtatgaaatgctgactctcatgtcaccaccgctaggcctcggc
aagagatgtccctccaaggtggcctataagaggttggtcctgatgaacatgccagtggct
gaggacatgacagtccacttcacctccacacttatggctctgatccggacagctctagac
attaaaattgccaaaggtggtgcagatagacagcagttagactcagaactacaaaaagaa
accctggccatttggcctcacctgtcccagaagacgctggatctgcttgtgcccatgcct
aaagcctctgacctgacagtgggcaaaatctatgcagcaatgatgattatggactactat
aaacagagcaaggtgaagaagcagaggcagcagctggaagaacagaaaaatgcacccatg
ttccagcgcatggagccctcatcactgcctcaggagatcattgctaacgccaaagccctg
ccttatctccagcaggaccctgtttcaggcctgagtggtcggagtggatacccttcaatg
agtccactctccccccaagaaatattccagttggcttgtatggacccagctgatgatgga
caattccaggaacagcaatctctggtggtaacagaccctagctctatgcgacgctcattt
tctacaattcgggataagcgttcaaattcctcatggttggaggagttctccatggagcgt
agcagtgaaaatacctacaagtcacggcgcagaagttaccattcctcgctgaggctgtca
gcccaccgtctgaattctgactctggccacaagtctgacactcaccgctcaggaggcagg
gagagaggcagatccaaagagagaaagcacctactctcccctgatgtctcccgctgcaat
tcagaggagagaggcacccaggctgactgggagtccccagagcgtcaacagtccaggtca
cccagcgagggacggtcacagacccccaacagacagggcactggttccctgagtgagagc
tccattccctccgtctctgacaccagcaccccaagacgtagtcgtcgccagctcccgcct
gtgccaccaaagcctcggccgctcctatcttacagctccctgatgagacacactggtggc
atctctccacctcctgatggaagtgagggaggatccccactggcctctcaagccctggag
agcaacagcgcttgcctgaccgagtcttccaactccttgcacccccagcagggccagcac
tcttccccacagcactacatctctgagccctatctggccctccatgaagactcccacgcc
tcggactgtggcgaggaggagacactcacctttgaggcagccgtggcaactagcttgggc
cggtccaacaccattggctctgccccacccctgcggcacagctggcagatgcctaatggg
cactatcgacggcggaggcgtggggggcctgggcctggcatgatgtgtggagctgtcagt
gacctcctgagtgacacggaagaagatgataagtgctag

DBGET integrated database retrieval system