KEGG   Cricetulus griseus (Chinese hamster): 100773620Help
Entry
100773620         CDS       T02813                                 

Gene name
Si
Definition
(RefSeq) sucrase-isomaltase, intestinal isoform X2
  KO
K01203  sucrase-isomaltase [EC:3.2.1.48 3.2.1.10]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00052  Galactose metabolism
cge00500  Starch and sucrose metabolism
cge01100  Metabolic pathways
cge04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100773620 (Si)
   00500 Starch and sucrose metabolism
    100773620 (Si)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100773620 (Si)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100773620 (Si)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.10  oligo-1,6-glucosidase
     100773620 (Si)
    3.2.1.48  sucrose alpha-glucosidase
     100773620 (Si)
Exosome [BR:cge04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100773620 (Si)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100773620
NCBI-ProteinID: XP_027247431
LinkDB All DBs
Position
1
AA seq 1814 aa AA seqDB search
MAKKKFSGLEISLIVLFIIVTIIAIALVVVLATKVPAVEELQSSSHPGKCPTEPNDPINE
RINCIPDQTPTQAKCEERGCCWRPWNNSIIPWCFFVNNHGYNAEAVTTKDTGLEARLNRI
PSPTLFGDDINSVLLTTQSQTSNRLRFKITDPNNKRYEVPHQFVKDVTGIPAADTLYDVQ
VTEKPFSIKVIRKSNNRVLFDTSIGPLVYSNQYLQISAKLPSDYIYGFGEHIHKRFRHDL
YWKTWPIFTRDELPGDNNHNLYGHQTFFMGIEDNSGKSYGVFLMNSNAMEVFIQPTPIVT
YRVIGGILDFYIFLGDTPGEVVQQYQELIGRPAMPAYWSLGFQLSRWNYKSLDAVKEVVR
RNREARIPYDAQVTDIDYMEDKKDFTYDEVAFKGLPEFAQDLHNHGQKYVIILDPAISIN
KRANGADYGTYVRGNEQNVWVSESDGTTPLIGEVWPGLTVYPDFTNPKTSEWWANECSLF
HQQVQYDGLWIDMNEVSSFIQGSLKGCSVNEMNYPPFTPGILDKLLYSKTLCMDAVQYWG
KQYDVHSLYGYSMAIATEKAVEKVFPNKRSFILTRSTFAGSGKHAAHWLGDNTASWEQME
WSITGMLEFGLFGMPLVGADICGFVADTTEELCRRWMQLGAFYPFSRNHNADGYAEQDPA
FFGQDSLLVKTSRHYLTIRYTLLPFLYTLFYKAHMFGETVARPFLHEFYEDPNSWIEDTQ
FLWGPALLITPVLKQGTEYVSAYIPDATWYDYETGEKKPWRKQRVNMYLPADKIGLHLRG
GYIIPTQEPDVTTTASRKNPLGLIVALDENQTAKGDFFWDDGETNGTIENGSYIFYTFSV
SNNILVVNCTHSSYSEGTALAFKTIKILGLTDTVTEVRTGENDQQMADHLAFTFDASNNV
LSITDLNFNLGKSFIVRWNQIFSDNERFGCYPDAGMATENLCVQRGCIWKEVSGLSGAPE
CYFPKDHNPYLLTSTQFSPTGITAELQLNTAGARIRLPSNPISNLRVEVKYHKNDMLQFK
IYDADHKRYEVPVPLNIPETPTSSYENRLYDVEIKENPFGIQVRRRSSGRLIWDSRLPGF
AFNDQFIQISSRLPSQYLYGFGEAEHTAFKRDLNWHTWGMFTRDQPPGYKLNSYGFHPYY
MALEDEGNAHGVLLLNSNGMDVTFQPTPALTYRIIGGILDFYMFLGPTPEVATRQYHEVI
GYPVMPAYWSLGFQLCRYGYRNTSEIEQLYEAMVAAKIPYDVQYTDINYMERQLDFTIGE
RFKDLPQFVERIRNEGMKYIIILDPAISGNETKPYPAFDRGIQKDVFVKWPNTNDICWAK
VWPDLPNIEINESLTEDEAVNASRAHVAFPDFFKNVTAEWWATEIFEFYNEKMKFDGLWI
DMNEPSSFVNGTVTNRCRNDTLNYPPYFPELTKRTEGLHFRTMCMETEQILSDGSSVLHY
DVHNLYGWSQVKPTLDALRKTTGLRGIVISRSTYPTAGRWGGHWLGDNYANWANLENSLI
GMLEFNLFGIPYVGADICGFFNDSEYHLCTRWMQVGAFYPYSRNHNIQFTRRQDPVSWNE
TFAEMSRNVLEIRYTLLPYFYTQMHEAHVHGGTVIRPLMHEFFDDRGTWEIYEQFLWGPA
FMVTPVIEPYRTSVTGYVPNARWFDYYTGEDIKVRGQKQTFAAPFDKINLHVRGGYILPC
QEPAQNTYLSRQNFMRLIVAADDNQTAQGTLFWDDGESIDTYERDLYTLIQFNLNQKNLT
NSILKNGHTNKYEMILGEVYVWGKGTTSVNEVNLTYGGNTLKTNFTQDAAKEILIIDLKQ
MDVFLNEPIEISWS
NT seq 5445 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaagaagttcagcggattagaaatctctctgattgtcctctttatcatagta
acaataatagctattgctctagttgttgtcttagcaacaaaggtgcctgctgtggaagaa
cttcaaagttcatctcatcctggaaagtgtcccactgaaccaaatgatcctatcaatgaa
agaataaactgcattccagaccaaactccaacacaggcaaaatgtgaagaacgtggctgt
tgttggcgcccctggaacaactccatcattccttggtgcttctttgtaaataaccatggc
tacaatgctgaggcagtaactacaaaagatactggacttgaagccaggttgaacaggatc
ccctctcctactctatttggggacgatattaatagtgtcctcctcacaactcagagtcaa
acctcaaatcgtttgcgcttcaagattacagatccaaataataagagatatgaagtacca
catcagtttgtaaaggacgttactggaatcccggcagctgacacactttatgatgtgcag
gtcacagaaaaacctttcagcatcaaagtgatcaggaaaagcaacaacagagtcttgttt
gacaccagtattggtccactggtgtattccaaccaatatttacagatttcagcaaaactt
ccaagtgactatatttatggctttggggaacatattcataagagatttcgtcatgactta
tactggaaaacatggccaatatttactcgagatgaacttcctggtgataataatcataat
ctctatgggcatcagacattcttcatgggcattgaagataactctgggaagtcatatgga
gtttttctcatgaacagcaatgcaatggaggttttcatccagccaactccaatagttact
tacagagttattggtggcatactagacttttatatatttcttggagacacaccaggagaa
gtagttcaacaataccaagagctcattggacgaccagcaatgccagcatattggagtctt
ggctttcaactgagtcgctggaattacaagtcattagatgcagtcaaagaagtagtaaga
agaaaccgggaagcccgcatcccatatgatgcccaagtcaccgatattgactacatggaa
gacaaaaaggacttcacttatgatgaagttgctttcaaagggcttcctgaatttgctcag
gatttacacaaccatggacaaaaatatgttatcatcctggacccagcgatatctataaat
aagcgggctaacggagcagactatggaacgtatgtgaggggtaatgaacaaaatgtttgg
gtgagtgagtcagatggaactacaccacttattggagaggtatggccaggattaacagtt
taccctgattttactaatccaaaaaccagtgaatggtgggcaaatgaatgcagtcttttc
caccagcaagtgcaatatgatggactttggattgacatgaatgaagtttccagctttatt
caaggttctctgaaagggtgcagcgtcaatgaaatgaattacccccctttcactcctggt
attcttgacaaacttctgtattccaaaaccctttgcatggatgctgtacagtactggggg
aagcagtatgatgtccacagcctgtatggatacagcatggccatagccacagagaaagct
gtggagaaagtttttcctaacaagagaagtttcatcctcactcggtcaacatttgccggc
tctgggaagcatgctgctcattggctgggagataacactgcctcgtgggagcagatggaa
tggtctatcacgggaatgctggagttcgggctgtttggcatgcctttggttggagcagac
atctgtggatttgtggctgacactacagaggaactctgcagaaggtggatgcaacttgga
gccttttatccattttctagaaaccataacgctgatggctatgcggagcaagatcctgca
ttttttggacaagactctcttctggtgaagacatcaaggcactacttaaccatccgctac
accttactccctttcctctacaccctgttctacaaagcccatatgtttggagagacagtc
gcaaggccatttcttcatgaattttatgaagaccctaatagctggattgaggacacccaa
tttctctggggccctgcactacttattactcctgttttgaaacagggaacagaatatgtg
agtgcatacattcctgatgctacctggtatgattatgaaacaggtgaaaaaaagccatgg
agaaagcaaagggttaacatgtaccttccagcagataagataggtttgcatcttagagga
ggctatatcatcccaacccaggaacctgatgtaacaacaacagcgagccgtaagaatcct
ctaggtcttattgttgcattagatgaaaatcagacagcaaaaggagacttcttctgggat
gatggtgaaactaacggaaccatagaaaatggaagctacatattttacaccttttcagtt
tccaataatatcttggttgttaattgcacacattcgtcatattcagaaggaactgccctt
gcttttaaaacaatcaaaatccttgggctgacagacactgtaacagaagttagaacagga
gaaaatgatcaacaaatggcggatcatcttgctttcacgtttgatgcttccaataacgtt
ctctcaattacagatctcaactttaatcttggaaaaagctttatagttagatggaatcaa
attttctcagacaatgagcgatttggttgttatccagatgcaggcatggcaactgagaac
ttatgtgtacagcgaggctgcatttggaaagaggttagtgggctatccggtgcacctgaa
tgctactttcctaaagatcacaatccctatttgttaacttcaactcaattttcaccaacg
ggtataacagctgaactccaattgaatactgcaggagctagaatacgccttccttctaat
cccatctccaatctccgtgtggaagtaaaatatcacaaaaatgacatgctacagtttaag
atttatgatgccgatcataagagatatgaagttccagtaccattaaacattccagagacc
cctacaagctcttatgaaaataggctctatgatgttgaaatcaaggaaaacccttttggc
atccaggttcgaaggagaagtagtggacggcttatctgggattctcgccttcctggattt
gcattcaatgaccaattcattcagatatctagccgtctgccatcacaatatttatatggt
tttggggaagcagaacacacagcattcaagagagatttgaactggcatacttggggaatg
ttcacaagagatcaacctcctggttataaactcaattcctatggattccatccctattat
atggctttggaagatgagggcaatgctcatggagttctgttactgaacagcaacggaatg
gatgttacattccagccaactcctgctctaacttaccgcataattggaggaatcctggat
ttttacatgtttttgggaccaaccccagaagttgcaacaaggcaataccatgaagtaatt
ggctatccagtcatgccagcttactggtcgctgggatttcaattatgtcgttatggatac
agaaatacttcagagattgagcaactatatgaagctatggtggctgctaagatcccctat
gatgtccagtacacagacattaattacatggaaaggcaactagacttcacaattggtgaa
cgattcaaggatcttccccagtttgttgaacgaatcagaaacgagggaatgaaatatatt
attatcttggatccagcaatttcaggaaatgaaacaaagccttaccctgcctttgataga
ggaatacagaaagatgtctttgtcaagtggcctaatacaaatgatatttgttgggcgaag
gtttggccagatttacctaatattgaaataaacgagagtttaacagaagatgaagctgtt
aatgcttccagagcacatgtagcatttccagacttcttcaagaatgtcacagcagagtgg
tgggcaacagaaatttttgaattctacaatgaaaaaatgaagtttgatggcttgtggatt
gatatgaacgagccttccagttttgtaaatggaacagttactaatagatgcagaaatgat
acactaaattaccctccttatttcccagaactcacaaaaagaacagaggggttacatttc
cggaccatgtgcatggaaactgaacagattcttagtgatgggtcatcagttttgcattat
gatgtgcacaatttatatggatggtcacaagttaaacccactctggatgcattacggaag
accactggcctgagagggatagtcatctctcggtctacatatcccacagctggtcgatgg
gggggacactggctcggagacaattatgcaaactgggcaaatttggaaaattcactcatt
ggtatgctagaatttaatctttttgggataccatatgttggagcagatatctgtggtttt
tttaatgattcagaatatcatctctgtactcgttggatgcaagttggagccttttatcca
tattcacgaaaccacaacattcaatttaccagaaggcaagatcctgtttcctggaatgaa
acttttgctgaaatgtccaggaatgttctagaaatcagatacacgttgctgccctatttc
tacacacagatgcatgaagcccatgttcatggtggcactgtcatcagacccctgatgcat
gagttctttgatgataggggaacctgggaaatatatgagcagttcctgtggggtccagca
tttatggtgactcctgtcattgagccttacagaaccagtgtgactggctatgtccctaat
gctcggtggtttgactactatacaggggaagatataaaggtcagaggacaaaagcaaaca
tttgcagctccttttgataaaataaatctgcatgtccgaggaggttatattctaccatgc
caagagcccgcacagaacacatatttaagtcgacagaatttcatgaggctcatcgttgct
gcagatgacaatcaaacagcacaaggaactctattttgggatgatggagagagtatagac
acttatgaaagagatctctacaccttgatacaattcaatctaaaccagaaaaatttaaca
aactctatattgaaaaatgggcatacaaacaaatatgagatgatacttggagaagtctat
gtgtgggggaaaggaacaaccagcgtcaacgaggttaatttgacttatggtggaaataca
ctaaaaactaactttactcaagatgcagctaaggagatactaataattgacctgaaacaa
atggatgtttttcttaatgaaccaatagaaataagctggtcatga

DBGET integrated database retrieval system