KEGG   Cricetulus griseus (Chinese hamster): 100773662
Entry
100773662         CDS       T02813                                 

Gene name
Nlrp4
Definition
(RefSeq) NACHT, LRR and PYD domains-containing protein 4 isoform X3
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
KEGG Orthology (KO) [BR:cge00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    100773662 (Nlrp4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:cge04054]
    100773662 (Nlrp4)
Membrane trafficking [BR:cge04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100773662 (Nlrp4)
Pattern recognition receptors [BR:cge04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   100773662 (Nlrp4)
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH LRR_6 AAA_16 AAA_25 NB-ARC AAA_7 AAA_33
Other DBs
NCBI-GeneID: 100773662
NCBI-ProteinID: XP_027286667
LinkDB
Position
9
AA seq 980 aa
MASFFSDFGLMWYLKELNKKEFMKFKEVLRQEIAESGLQHIPWNEVKKASREHLANLLVK
HYEQKAWDVTFRIFQNINRKDLSERAAEEMAGHSKMYQAYLKNMLSHDWSRKFKIAIECF
GNEDLTQDNCSRLWNLFVPKANEKPHTVLLIGMSGVGKTVFLAQLMRAWSEGLMFQNEFS
YVFYLCCHEIKQLKTASLADLLSREWPRPSAPIAEIVSQPAKLLFIIDSLEGLNCDWSEP
ESELCDNWMQKCPVSILLSSLLRRKLLPESSLLITATPEAFEKLGDRIEYTVKNFVTGFN
ENSRRSCFQRVFQDEDTAQEVFTLVRENEQLYNICHVPSLCWMVATCLNDEVKRGGHLSA
VCRCTTSVFAAYVLNLFIPQSAHYPSKKSQALLRGLCSVAAEGMWTDNFAFNQKDLEKNG
VFHSDISTLLNMKILLKSRDSKNLYTFFHPSIQEFCAALFYLVNSHVDHPSKDVLCVETL
LFTFLKKVRVQWIFLGSFIFGLLHKSEQAKLEAFFGYQLSQEVKQMLCQSLEKISADKEL
RKQIDDMKLFYCLFELEDDGFVTQVMTFLPQIKFVAKEYSDLIVAAYCLKNCSTLQNLSI
STQDILWKENDPIYLRKLLLRWQDLCSVLGSSEQIQVLQVKDTYLDELAFLELYNHLKNP
RCAPQTFQVNNVTLWYNQLFFELLTQNHNLHHLDLSLTCLSHSDVKLLYDALNQEECHIE
ELLLSGCQLSHDDCIIFASILISSKKLRHLNVSYNNLDKGMYLLSKALCHPDCVLKDLVL
ASCSLSKQCWNYLSDVLKRNKTLSHLDVSSNDLQDEGLKVLCQALSLPDSALKSLFLRRC
LITSSGCQYLAEVLSSNQNLISLQVSNNKLEDAGVKLLCEAIKEPNCRLENLGLEACELT
GASCEYLVSALSQNETLWAINLLKNALDLRGLAMLFEALNVHGCSPNVLGLQITIPDKET
QELLIAEKEKNPYLAILSRV
NT seq 2943 nt   +upstreamnt  +downstreamnt
atggcctctttcttttctgattttggtcttatgtggtacctgaaagagctaaacaagaaa
gagttcatgaagttcaaggaggtcctcaggcaggagatagcagagagtgggctgcagcac
attccctggaacgaagtgaagaaggcatcccgggaacaccttgccaacttactggtgaag
cattatgagcagaaagcctgggatgtgaccttcagaatcttccagaatatcaataggaag
gatctcagcgagagggcagcagaagagatggctggacactcaaagatgtatcaagcttat
ctgaagaatatgctgagccatgattggtccagaaagttcaaaatcgcgattgagtgtttc
gggaatgaggacctcacccaggacaactgcagccgtttatggaatcttttcgtgccaaag
gcaaatgagaagccacacaccgtgctcctgataggaatgtcaggagttggcaagacagtg
ttcttggcccagttaatgcgagcctggtcagaaggcctgatgtttcagaacgaattctcc
tacgtcttctacctgtgctgtcacgaaataaagcagttgaagacggcgagcctggccgac
ctgttgtccagagagtggcccagaccctcagctcccatagcagaaatagtatcccagcct
gcaaagctcttgttcatcattgacagcttggaagggctcaattgtgattggtctgaaccg
gaatcggagctgtgtgataattggatgcagaagtgtcccgtgagtatactcctgagcagt
cttctcaggaggaagttactcccagaatcctctctcctcatcacagctaccccagaggct
ttcgagaagttgggagacaggatagagtacacagttaagaacttcgtgacagggttcaat
gagaacagtaggaggtcgtgtttccagagggtgttccaagatgaggacacagcccaagaa
gtctttacgttggtgagggaaaacgaacagttgtacaatatatgtcacgttccttcactc
tgctggatggtggctacttgtctaaatgatgaggtaaagaggggaggacacctgagcgcc
gtctgccggtgtaccacctccgtgttcgccgcttacgttctcaatttgttcattccccaa
agtgctcactatccaagtaagaaaagccaagcgctgttgcgaggcctgtgttccgtggcg
gctgagggcatgtggactgacaactttgcctttaaccagaaggatcttgagaaaaacggg
gtcttccactcagacatctccacactgctgaacatgaagattcttctaaagagcagggac
tccaagaatctctacacattcttccacccatccatccaggagttctgtgccgccctgttt
tatctggtgaacagccacgtggaccaccctagtaaagatgtcctctgtgtggagacactc
ctgtttacatttctaaagaaagtcagggtgcagtggatcttcttgggctccttcatcttt
ggcctgctacacaagtcagaacaagcaaagctagaggcgttttttggctaccagttgtcc
caggaggtaaagcagatgttgtgtcagagcctggaaaagataagtgccgacaaagaactt
cggaaacaaatcgatgacatgaaactgttttactgtctatttgagttggaggatgacggc
tttgtcacgcaggtgatgaccttcctgccgcagatcaagtttgtggctaaggagtattct
gatctgatcgtggccgcctactgcttgaagaactgttccacgctgcagaatttatccatt
tcaacccaagacatcctgtggaaagaaaacgaccccatctatctgagaaagctgctcctc
cgttggcaagatttgtgttctgtgcttggaagcagtgagcaaatccaggtcctccaggtg
aaagacacttatctcgatgagttggccttcttggagttgtataatcacctgaagaatccc
aggtgtgcccctcaaacattccaggtaaataacgtgaccttgtggtacaaccaactgttc
tttgagctgctgactcagaaccacaacctgcatcacctggacctcagcctcacttgtctt
tcccacagcgatgtaaaactgttgtacgatgccctgaaccaggaagagtgtcacatagaa
gagctcctgttgtcaggctgccagctttcccatgacgactgcataatctttgcctccatc
ttgatcagcagcaagaagctgaggcatctcaatgtctcgtacaacaacttggacaaaggg
atgtacttgcttagcaaggctttgtgccacccagactgtgttctgaaggacttagtgttg
gccagctgctccctcagtaagcagtgttggaactacctttctgatgttctgaagcgaaac
aaaaccctgagccacctagacgtcagctccaatgacctgcaggacgaaggactgaaggtt
ctctgccaggctctgagtctcccggacagtgccctgaagtcactatttttgagacgttgt
ctcatcaccagtagtggctgccagtatctggctgaggtcctcagcagcaaccagaacctg
ataagcctccaggtttccaacaataagcttgaagatgccggcgtgaagctgctgtgtgaa
gctatcaaagaacccaactgccgcttagagaatctcgggttggaagcctgtgagctaact
ggtgcctcttgtgagtacctggtttctgctcttagtcaaaatgaaaccctgtgggcaatc
aacctgctgaagaacgccttggacctcagggggttggctatgctgtttgaggctctgaat
gtccacgggtgttccccgaatgtgcttgggcttcaaattactatccctgataaggaaacc
caggagcttctgattgccgagaaggagaaaaatccctacttggccatcctaagccgtgtg
taa

DBGET integrated database retrieval system