KEGG   Cricetulus griseus (Chinese hamster): 100773953
Entry
100773953         CDS       T02813                                 

Gene name
Tgfbr2
Definition
(RefSeq) TGF-beta receptor type-2 isoform X1
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04010  MAPK signaling pathway
cge04060  Cytokine-cytokine receptor interaction
cge04068  FoxO signaling pathway
cge04144  Endocytosis
cge04218  Cellular senescence
cge04350  TGF-beta signaling pathway
cge04380  Osteoclast differentiation
cge04390  Hippo signaling pathway
cge04520  Adherens junction
cge04659  Th17 cell differentiation
cge04926  Relaxin signaling pathway
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge05142  Chagas disease
cge05161  Hepatitis B
cge05166  Human T-cell leukemia virus 1 infection
cge05200  Pathways in cancer
cge05202  Transcriptional misregulation in cancer
cge05210  Colorectal cancer
cge05212  Pancreatic cancer
cge05220  Chronic myeloid leukemia
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100773953 (Tgfbr2)
   04350 TGF-beta signaling pathway
    100773953 (Tgfbr2)
   04390 Hippo signaling pathway
    100773953 (Tgfbr2)
   04068 FoxO signaling pathway
    100773953 (Tgfbr2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100773953 (Tgfbr2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100773953 (Tgfbr2)
  09143 Cell growth and death
   04218 Cellular senescence
    100773953 (Tgfbr2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100773953 (Tgfbr2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100773953 (Tgfbr2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100773953 (Tgfbr2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100773953 (Tgfbr2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100773953 (Tgfbr2)
   05202 Transcriptional misregulation in cancer
    100773953 (Tgfbr2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100773953 (Tgfbr2)
   05212 Pancreatic cancer
    100773953 (Tgfbr2)
   05225 Hepatocellular carcinoma
    100773953 (Tgfbr2)
   05226 Gastric cancer
    100773953 (Tgfbr2)
   05220 Chronic myeloid leukemia
    100773953 (Tgfbr2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100773953 (Tgfbr2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100773953 (Tgfbr2)
   05161 Hepatitis B
    100773953 (Tgfbr2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100773953 (Tgfbr2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cge01001]
    100773953 (Tgfbr2)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100773953 (Tgfbr2)
Protein kinases [BR:cge01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   100773953 (Tgfbr2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 100773953
NCBI-ProteinID: XP_027271118
LinkDB
Position
4
AA seq 592 aa
MGWGLLRGLWPLHIVLWTRIASTIPPHVPKSDVEMEAQKDVPIYLSCNRTIHPLKRFNSD
MMTSDNSGAVKLPQLCKFCDVRSSTCDNQKSCMSNCSITAICEKPYEVCVAVWRKNDENI
TLETVCHDPKLTYHGFTVEDATSPKCIMKEKKRAGETFFMCACNVEECNDHIIFSEEYTA
SNPDLFLVIIQVTGVSLLPPLGIAIAVIVIFYCYRVHRQQKLSPSWESSKARKLMEFSDN
CAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVA
VKIFPYEEYTSWKTEKDIFSDINLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQE
YLTRHVISWEDLRKLGSSLARGIAHLHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCL
CDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLENVESFKQTDVYSMALVLW
EMTSRCNAVGEVKDYEPPFGSKVREHPCVESMKDNVLRDRGRPEIPSFWLNHQGIQIVCE
TLTECWDHDPEARLTAQCVAERFSELEHPDRLSGRSCSQEKIPEDGSLNTTK
NT seq 1779 nt   +upstreamnt  +downstreamnt
atgggttgggggctgctccggggcctgtggccgctgcacatcgtcctgtggacgcgcatc
gccagcacgatcccgccgcacgttcccaagtcggatgtggaaatggaggcccagaaagat
gtacccatctacctaagctgtaataggaccatccatccactgaaacgctttaacagtgac
atgatgaccagtgacaacagcggtgcagtcaagcttccacagctgtgtaagttttgtgac
gtgagatcgtcgacttgtgacaaccagaagtcttgcatgagcaactgcagcatcacggcc
atctgcgagaagccctatgaagtctgcgtggctgtgtggaggaagaatgatgagaacatc
acactggagaccgtttgccatgaccccaagctcacctaccatggctttaccgtggaggac
gccacttctcccaagtgtatcatgaaggaaaagaagagggccggtgagactttcttcatg
tgtgcctgcaacgtggaggagtgcaatgaccacatcatcttttcagaagaatataccgcc
agcaatcctgacctgttcctggtcattatccaagtgaccggcgtcagcctcctgcctccg
ctggggattgctatagctgtgatcgtcatcttctactgctatcgtgtccatcggcaacag
aagctgagcccatcctgggaaagcagcaaggcccggaagctcatggagttcagcgacaac
tgtgccattatcctggaagatgaccggtcagacatcagctccacgtgtgccaacaacatc
aaccacaacacagagctgctgcccattgagctggacacactggtggggaagggccgcttt
gcagaggtctacaaggccaagctgaagcaaaacacttcagagcagtttgagaccgtggcg
gtcaagatcttcccctatgaggagtacacttcctggaagacggagaaggacatcttctca
gacatcaacctgaaacacgagaacatcctgcagttcctgactgctgaggagcggaagaca
gagctgggcaagcagtactggctgatcacagcattccacgccaagggcaacctgcaggaa
taccttacaaggcatgtcatcagctgggaggacctgcgcaagctgggcagctccctggcc
aggggcatcgctcatctccacagtgaccacactccttgtgggaggcccaagatgcccatc
gttcatagggacctcaagagctccaacatcctcgtgaagaacgatttgacctgttgcctg
tgtgactttgggctgtccttgcgcctggacccaactctgtctgtggatgacttggccaac
agcggacaggtgggaacagcaagatacatggcccctgaggttctagaatccaggatgaat
ttggaaaatgtggagtccttcaagcagacagatgtctactccatggctctggtactctgg
gagatgacatcccgttgcaatgcagtgggagaagtgaaagattatgaacccccatttggg
tccaaggtgagggagcacccctgtgtggagagcatgaaggacaacgtgctgagagatcga
ggaaggccggaaatccccagcttctggctcaaccaccagggcatccagatcgtgtgcgag
acactgacagagtgctgggaccatgatcctgaggcccgactcaccgcccagtgtgtggca
gagcgcttcagtgagctggagcatccggatagactctctgggaggagctgctcccaggag
aagattccagaagatggctcgctgaacactaccaaatag

DBGET integrated database retrieval system